KEGG   Thermoanaerobacterium saccharolyticum: Tsac_2012Help
Entry
Tsac_2012         CDS       T02137                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tsh  Thermoanaerobacterium saccharolyticum
Pathway
tsh00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tsh01100  Metabolic pathways
tsh01110  Biosynthesis of secondary metabolites
tsh01130  Biosynthesis of antibiotics
tsh01230  Biosynthesis of amino acids
Module
tsh_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tsh00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tsac_2012
Enzymes [BR:tsh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Tsac_2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS Ad_Cy_reg QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFK87016
UniProt: I3VWX1
Position
complement(2057097..2057879)
Genome map
AA seq 260 aa AA seqDB search
MILDDIIVKKKIQVEIKKIEKPLDGILKEIKNDKNMRNFKEALIGDDISIIAEIKKASPS
KGIMVEDFDHIKIAKLYENVDVDAISVLTEKNYFKGDDAYINDVKEVTSKPILRKDFIFD
EYQIYESKLIGADAVLLIVTVLGDDLKKFYDTAKKIGLDAIVEVHDERELEIALNANVDI
LGINNRDLKDFHVDLRTTERLVRYVPSGVLLVSESGIKTSDDVKFLKSLGVNAVLIGETF
MNIIKNGGKIDDFVIQSKGV
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgatacttgatgatattatcgttaagaaaaaaatacaggtggaaataaaaaaaatcgaa
aaaccgctggatggtatattaaaagaaattaaaaatgataaaaatatgaggaattttaaa
gaagcgttgattggtgatgatatatcgataatagctgaaataaaaaaagcttctccatct
aaagggataatggtagaagactttgatcacataaaaattgctaagctatatgaaaatgtt
gatgttgatgccatatctgttcttacagaaaaaaattattttaaaggagatgatgcatat
ataaacgatgtaaaagaagtaacatcaaaacctattctcagaaaagacttcatatttgac
gaataccaaatatacgaaagcaaattaattggtgcagatgctgtcttgcttatagtgact
gtacttggagatgatttaaagaagttttacgatactgctaaaaagattggattagatgct
attgttgaggttcatgacgaacgtgaacttgaaatagcattaaatgcgaatgtggatatt
ttaggcataaacaacagagatttaaaggattttcacgttgatttaaggacgacagaaagg
cttgttagatacgtgccaagcggtgttttactggtgtctgaaagtggcataaagacttct
gatgacgtaaaattcttaaaatcattaggtgtgaatgctgtcctaatcggtgaaacattt
atgaatataatcaaaaatggcggtaaaattgatgatttcgtaattcaatcaaagggtgtt
taa

DBGET integrated database retrieval system