KEGG   Thermococcus sibiricus: TSIB_0175Help
Entry
TSIB_0175         CDS       T00928                                 

Definition
(GenBank) ArgE/DapE-related deacylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00300  Lysine biosynthesis
tsi01100  Metabolic pathways
tsi01120  Microbial metabolism in diverse environments
tsi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TSIB_0175
Enzymes [BR:tsi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TSIB_0175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 Peptidase_M28 Peptidase_M42 Aconitase_C
Motif
Other DBs
NCBI-ProteinID: ACS89243
UniProt: C6A0U8
Position
172522..173865
Genome map
AA seq 447 aa AA seqDB search
MKILMVRTMKILELLSDLVEFETVNDPAKGIKPSKDCPKFVMDILSSWGIETELIEKDGY
YAVYGELGEGKPKILFMAHFDVVPVNREEWNTEPFKLVIKGNKAYGRGSADDKGNVASVM
LAIKELSKMDLEGKVLFAVTGDEEIGGVLAMHIAEKLRDEGKMPEYMINADGVGMKPIIR
RRKGFGVTIRMPSEKVKLKGTLKEQKFRINTPIVETRHAAYFLPGVDTHPMIAVSHFLRN
SNVAVVSLEGKFLKGNIVPSEVTLKYLEVGDGEEIEVDLGLTRLLKAIIPLVRAPIKTEK
YSDYGVSITPNLYSYQGNKHVLRLDIRAMSYSQEAIETTLKEIIRFNIPNAEITIRSNEK
AGYLFTPPDEGIVTTMLKILEGFDQKAEPVEGPGAADSRFFTPYGVKAIDFGPKGGNIHG
PNEYVDIESLKVLPDVYKEVALRLIKG
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttaatggtgaggactatgaaaatattggaacttctctcagaccttgtggag
tttgagacggtaaacgacccagcaaaagggattaagccctctaaagactgccccaaattt
gtaatggacatcctctcttcatggggcattgagactgagttgatcgagaaggatggatac
tatgccgtttacggtgaactaggggagggaaaaccaaaaatcctttttatggcccatttt
gacgttgtacccgtaaacagggaggaatggaatacagagccatttaaattagtgataaag
ggcaataaggcatatgggagaggaagtgccgatgataagggaaatgttgcctcagtaatg
ctggctattaaggaattatcgaagatggatcttgagggaaaagttctctttgcagttacg
ggggatgaagaaataggtggggtcttagccatgcacattgcggagaaacttagagatgag
ggtaaaatgcccgaatatatgataaacgccgatggggttggcatgaaaccaattattcga
agaagaaaaggctttggagttacaataaggatgccttcagaaaaagttaaacttaaaggg
actttaaaggaacaaaagtttagaataaacactcctatagttgaaacgaggcatgctgct
tatttccttccgggggtcgacactcatccaatgatagctgtttcccatttcctaaggaat
agcaatgttgcagttgtctctctcgaaggcaaattcttaaaggggaacattgtaccgagt
gaagtgacccttaaatatcttgaagtgggtgatggggaagagattgaggtagatcttgga
ttgacaaggcttttgaaagctataatacctcttgtgagggccccaataaagactgaaaag
tacagtgattatggtgtctccataacgcctaacttatattcttatcaggggaataaacac
gttctaaggttggatataagggcgatgagttattctcaggaggctattgaaacgactttg
aaagagattatcagattcaacattcctaatgcagaaatcacgattagaagtaatgaaaaa
gctggttatctttttacacctccagatgagggaatagtgacaacaatgctaaaaatactc
gaggggtttgaccagaaagcggagcctgtagaagggcctggagcggctgattcaagattt
ttcacaccttatggagtcaaggcgatagattttgggcccaaaggcgggaatattcatggg
cctaatgaatatgtggacattgaatcccttaaagtgttgcctgatgtatacaaagaggtt
gcattgagacttattaagggttaa

DBGET integrated database retrieval system