KEGG   Thermococcus sibiricus: TSIB_0661Help
Entry
TSIB_0661         CDS       T00928                                 

Definition
(GenBank) Probable aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00260  Glycine, serine and threonine metabolism
tsi00630  Glyoxylate and dicarboxylate metabolism
tsi00670  One carbon pool by folate
tsi01100  Metabolic pathways
tsi01110  Biosynthesis of secondary metabolites
tsi01130  Biosynthesis of antibiotics
tsi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tsi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    TSIB_0661
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TSIB_0661
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    TSIB_0661
Enzymes [BR:tsi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     TSIB_0661
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-ProteinID: ACS89726
UniProt: C6A281
Position
complement(613485..614678)
Genome map
AA seq 397 aa AA seqDB search
MKRVHIFDWHKEHAKKVEEFAGWEMPIWYSSIKEEHLAVRNGVGIFDVSHMGEVFFKGKD
ALKFLQYVTTNDISRPPAISGTYSLVLNERGAVKDETLVFNMGNDTYMMVCDSDAFEKLY
AWFTSIKRAIEQYTELDLEIENKTYDYVMFSIQGPKAKDLAMELFGIDINQLWWFQAKEV
ELDGIKMLLSRSGYTGENGFEVYFEDVNPYHPDESKHGKPEKALYVWEKILEAGQKYGIK
PAGLGARDTLRLEAGYTLYGNETKELQLLSTDIDEVTPLQANLEFAIFWDKEFIGKEALL
KQKERGLPSKMVHFKMVDRGVPRAGYKVYADGKEIGEVTSGTLSPLLGIGIGVAFVKPEY
AKPGVEIEIEVREQKKKALTVAPPFYDPKKYGTFREE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaagagggtgcacatttttgactggcataaagagcacgcaaaaaaagtggaagaattt
gcaggatgggaaatgccaatttggtattcaagcataaaagaagaacacttggccgttaga
aatggtgtagggatttttgatgtttctcatatgggggaagtattctttaaaggaaaagac
gctctcaagtttctccagtatgttacaacaaacgatatctcaagaccaccagcaataagc
ggtacctacagtcttgttcttaatgaaagaggggccgttaaggacgagaccctcgtgttt
aatatgggcaacgatacatatatgatggtatgtgacagcgatgcttttgaaaaactctat
gcatggtttacctcaattaaaagggcaattgaacagtataccgagcttgacttggaaata
gagaacaaaacttatgactatgttatgttctcaatccaaggtcctaaggccaaagatttg
gccatggagctctttggaattgacatcaaccagctctggtggttccaagccaaagaagtc
gagcttgatggcataaagatgcttctctcaaggagcggttacactggagagaacggcttt
gaggtttacttcgaagatgtaaatccgtatcatcccgatgaaagcaagcacggaaagccc
gagaaagccctctacgtatgggaaaagattcttgaagctggacaaaaatacggtataaaa
cccgccggattgggagcaagagacaccctaagacttgaagctggatacaccctctatggc
aatgaaacgaaggagctccaactcttgagtaccgacattgatgaagtaactcccctgcag
gcaaacctcgagtttgcgatcttctgggacaaggagttcatcgggaaagaagcacttcta
aagcaaaaggagaggggccttccaagcaagatggtgcacttcaaaatggttgacagaggg
gtaccaagagcaggttacaaagtttatgctgatggcaaggaaatcggtgaagtcacaagt
ggaaccctctcgcctctattgggcattggaataggggtagcatttgttaaaccagagtac
gctaaaccgggggtagagattgagattgaagtaagagaacaaaagaagaaggccttaaca
gtagctccaccattctatgatcccaagaaatatggcacatttagagaggagtga

DBGET integrated database retrieval system