KEGG   Thermococcus sibiricus: TSIB_0949Help
Entry
TSIB_0949         CDS       T00928                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00010  Glycolysis / Gluconeogenesis
tsi01100  Metabolic pathways
tsi01110  Biosynthesis of secondary metabolites
tsi01120  Microbial metabolism in diverse environments
tsi01130  Biosynthesis of antibiotics
tsi01200  Carbon metabolism
tsi01230  Biosynthesis of amino acids
Module
tsi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tsi_M00002  Glycolysis, core module involving three-carbon compounds
tsi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_0949
Enzymes [BR:tsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     TSIB_0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N 2-Hacid_dh_C GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACS90007
UniProt: C6A312
Position
862089..863093
Genome map
AA seq 334 aa AA seqDB search
MKVKVGINGYGTIGKRVGYAVSKQADMELVGVAKTKPDFEAYRAKELGIPVYAASPDFVP
RFEKVGFEIVGTLEDLLEKVDVIVDATPGGMGEKNKALYEKAGVKAIFQGGEKASVAEVS
FVAQANYEKALGKDYVRVVSCNTTGLTRTLNAIKDYIDYVYAVMIRRAADPNDIKRGPVN
AIKPSVEVPSHHGPDVQTVIPINIETMAFIVPTTLMHVHSVMVELKKPLTREDVIKIFEN
TTRVLLFEKERGFDSTAQLIEFARDLHREWNNLYEIGVWKESISVKGNRLFYIQAVHQES
DVVPENIDAIRAMFELADKWESIKKTNKSLGILK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaggtgggaattaacggttacggtactataggaaaaagagtgggttatgca
gtatcaaaacaggctgatatggaattagtgggtgttgcaaaaacaaaaccagattttgag
gcttaccgagctaaagagcttgggatacccgtttatgccgcatcgcctgattttgttcca
agatttgagaaagttgggttcgagattgttggaacccttgaagatctcctcgagaaagtg
gatgtaattgtggatgctactcccggagggatgggcgagaaaaacaaggccctctacgag
aaagcaggagttaaggcaatattccaaggcggagaaaaggcaagtgttgctgaggtttca
tttgttgctcaggcaaactatgagaaagctttgggcaaagactatgttagagtagtttct
tgcaacactacaggtttaacaagaactttgaatgcaataaaggactacattgactacgta
tatgctgtgatgattagaagggccgcagatcccaacgacatcaaaagaggtcccgttaat
gccataaaacccagtgttgaagttccttcccatcatggaccagatgtacagaccgtaatt
ccaataaacattgaaacaatggcctttatcgtaccaacaaccctcatgcacgtccacagt
gtaatggtggagctcaaaaagccccttacaagggaagatgttattaagatttttgaaaac
actacaagagttctgctatttgagaaggaaaggggctttgacagtacagcccagttgata
gaattcgcccgtgatttgcacagggagtggaacaacctctatgagataggagtgtggaag
gaaagcattagcgtaaagggtaacaggctattctacatccaagcggttcatcaggagagt
gatgtggttccagaaaatattgatgcaataagagctatgtttgaattagcggacaagtgg
gagagtatcaagaagactaacaaaagtctcggtattttgaagtag

DBGET integrated database retrieval system