KEGG   Thermococcus sibiricus: TSIB_1082Help
Entry
TSIB_1082         CDS       T00928                                 

Definition
(GenBank) Nicotinamide-nucleotide adenylyltransferase
  KO
K00952  nicotinamide-nucleotide adenylyltransferase [EC:2.7.7.1]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00760  Nicotinate and nicotinamide metabolism
tsi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsi00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    TSIB_1082
Enzymes [BR:tsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     TSIB_1082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CTP_transf_like HIGH_NTase1
Motif
Other DBs
NCBI-ProteinID: ACS90136
UniProt: C6A3E1
Position
complement(985665..986225)
Genome map
AA seq 186 aa AA seqDB search
MRGLFVGRFQPVHNGHLKALEYVFEEVEEVIIGIGSAQVSHTLKNPFTTSERMEMLIRAL
DEKGIPRGKYFLVALPDINFNSIWAPYVEAIVPKFDIVFTGNSLVAQLFRERGYKVIVQP
MFRKDILSATEIRRRMIEDQTWEELVPKSVVEYIKEIKGVERIKMLATDLEKNEKELQTP
LRIPEF
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgagaggtctcttcgttggtcggtttcagcctgttcataatggccatttaaaagccctt
gaatatgtttttgaagaagttgaagaggttataatcgggattggaagcgctcaggtgagc
catacattgaaaaacccattcacaacgagtgaaagaatggagatgctcataagagcttta
gacgaaaagggaattccaagggggaaatactttctcgttgctctgccagacataaacttc
aactcaatctgggctccttatgttgaggcaatagtgccgaagtttgacatcgttttcaca
ggtaattcgcttgtcgcgcagctcttcagagagagaggctacaaggtcatagtacagcct
atgtttagaaaggacattctttccgccacagagataagaaggagaatgatagaagatcaa
acttgggaagaattagtgccgaagagcgtggtggagtatataaaggagattaagggagta
gaaagaataaagatgttagcaacagatttggagaaaaatgagaaggaacttcaaacacca
ttgaggattccggagttttaa

DBGET integrated database retrieval system