KEGG   Thermococcus sibiricus: TSIB_1407Help
Entry
TSIB_1407         CDS       T00928                                 

Definition
(GenBank) Asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00250  Alanine, aspartate and glutamate metabolism
tsi01100  Metabolic pathways
tsi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    TSIB_1407
Enzymes [BR:tsi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     TSIB_1407
Peptidases [BR:tsi01002]
 Cysteine Peptidases
  Family C44
   TSIB_1407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase Arginosuc_synth
Motif
Other DBs
NCBI-ProteinID: ACS90458
UniProt: C6A4B3
Position
1259679..1261208
Genome map
AA seq 509 aa AA seqDB search
MNCKNEPFYKEKQGNFLASSYLKKPVRKMCLIAGGRDKNIKSKLITMIKSGQHRGRDSFG
VWTNRGILKSEDFSEVNEIPDGDIGLLQCRLAMTGSKSFTQPFYNEFILIHNGEIYNHKQ
MRGFLESKGVEFESDVDTEVILRFLEFLIEMNKPISQAVSELMIALNGDYAVAFSDKENI
YLFRDPMGIRPLYYSPNGFFASEKKVLWKIGETAIPVNPGTLIKISANKIEAFELLSPLE
LKGKLFNHEKAKLGIQKGLDYSTKLRSSKRVRVLFSGGLDSSLIALLAKKYSKEVILYTA
GAEGSPDLEWARKVSEQLDLTLKEYVFDLEEVKEALYPVMFAIEEPNAMNLAIGIPMYFA
TKLAAEDRIKILLSGQGADELFGGYAKYITNPSLMEKDLIKMGEKNLARDDKIAMLNGVE
GRFPFLDLNLVRAGLRVPKKYKINNGTRKAILREVALELGLPKEVAYREKKACQYGTNAQ
KLLTKIAKQEGFKLSQFAEKLFKEVFEQR
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaattgcaaaaatgaacccttttacaaggagaaacagggaaattttttagcttcttct
tacctaaaaaagccggtgagaaaaatgtgcctaatagcgggaggacgagacaaaaatata
aaatccaaattaataacgatgataaaatcaggccaacatagaggaagagattcctttggg
gtttggactaatagaggaatattaaaaagtgaagacttttctgaagtgaatgaaataccc
gacggagatattgggctattgcagtgtcgtcttgctatgactggctcgaaatccttcact
caacctttttacaatgaatttatcctgatccataatggcgaaatctacaatcacaaacag
atgagaggatttctggaaagtaagggagttgaatttgaaagcgatgtggatactgaggtg
attttacgtttcttagagtttttgattgagatgaataaacccatatctcaagccgtaagt
gaattaatgatagctcttaacggtgactatgcagttgccttttccgataaggaaaatatt
tacctcttcagagatccaatgggaattaggccattatattattccccaaacggttttttt
gcctctgaaaagaaagtattatggaaaataggagaaaccgcaattcccgtaaaccccggc
acacttataaaaatttctgcaaacaaaatcgaggcttttgagcttttaagtcctttagaa
ctaaaaggaaaattattcaatcatgaaaaagccaaactaggcatccaaaagggcttagat
tattccacgaagctaagaagtagtaaaagggtgagagtactattttctggaggcctggat
agttccttaattgccctcctcgcgaaaaagtattcaaaggaagttatactttacactgcg
ggggctgagggaagtcctgacttagaatgggctagaaaagttagtgagcaactggactta
acactaaaagaatatgtatttgatctagaggaggtaaaagaagctctttatcctgttatg
ttcgcaatagaagaaccaaatgccatgaaccttgcaataggaatcccaatgtattttgca
acaaaacttgcagctgaagataggataaaaattcttctaagtggccaaggggccgatgaa
ctttttggtggatatgcgaaatatatcactaacccttcacttatggaaaaagatctaatt
aagatgggggagaaaaaccttgcgagagatgataagattgccatgcttaatggtgtagaa
gggagatttcctttcttggaccttaacttagttagagccggcctcagagtgcctaagaaa
tataaaatcaacaatggaaccagaaaagcaattttaagagaagttgctcttgaacttggc
cttcccaaagaagttgcatacagggagaaaaaggcctgccaatatggcactaatgcccaa
aaactcctcacaaaaattgctaaacaagaagggttcaaactttcccaatttgctgaaaag
ctttttaaagaagtatttgaacaaagataa

DBGET integrated database retrieval system