KEGG   Thermococcus sibiricus: TSIB_1641Help
Entry
TSIB_1641         CDS       T00928                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvatedehydrogenase complex (E2)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00010  Glycolysis / Gluconeogenesis
tsi00020  Citrate cycle (TCA cycle)
tsi00620  Pyruvate metabolism
tsi01100  Metabolic pathways
tsi01110  Biosynthesis of secondary metabolites
tsi01120  Microbial metabolism in diverse environments
tsi01130  Biosynthesis of antibiotics
tsi01200  Carbon metabolism
Module
tsi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_1641
   00020 Citrate cycle (TCA cycle)
    TSIB_1641
   00620 Pyruvate metabolism
    TSIB_1641
Enzymes [BR:tsi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TSIB_1641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding CAT
Motif
Other DBs
NCBI-ProteinID: ACS90692
UniProt: C6A4Z7
Position
1485236..1486054
Genome map
AA seq 272 aa AA seqDB search
MVSEEIRMIAEQYDINLSKIKGSGVNGEVTLEDLEKYIREHFFPKVREERKVFGIRKVIA
DRLSKSYREAVHVTLNMETEIDNLIQMRKKLTEKLGEKPSYTVLMLKCIAKAIREFIEIN
ATMEKEKIVIYDNVNINVAVDSPIGLITPVIRNVDKKNLKELLKDYADIVERAKKGSLKE
KDFVGGTFTITNLGMFGVDSFTPIINPPQIAILGLNRITQKPVIKNGETKVASVMVLSLT
FDHRAIDGAPAARFLERVKYYLEHPEKVFEVE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggtaagtgaagaaatcagaatgatagccgagcagtatgatattaacctttcaaagata
aaaggctcaggagttaatggggaagttacacttgaagaccttgaaaaatacatacgagag
catttcttcccaaaagtaagagaagagaggaaagtttttggaattagaaaagttatagca
gataggctttcaaagagctacagggaagctgtccatgtaaccctcaatatggaaacagag
attgacaacctcattcaaatgagaaaaaagctcactgaaaaacttggagaaaagccctca
tacacagttctgatgttgaagtgcattgcaaaggctattagagagttcatagagatcaat
gcaacaatggaaaaggaaaagatagtaatctacgataatgtaaatataaacgtggccgta
gacagcccaataggcttgataacccccgtaattaggaatgttgataaaaagaaccttaag
gagcttttaaaagactatgcagatatagttgagagggcaaagaagggttcacttaaagaa
aaggattttgtaggaggcactttcacgattacaaatctcggaatgttcggtgtggattcc
ttcaccccaataataaatcctccccaaatcgcgattttaggtttgaatagaataacacaa
aagccggtcataaagaatggggagacaaaagttgccagtgtaatggtgctctccctaacc
tttgaccacagggcaatagatggggctccggctgcaaggttcttggagagggttaaatac
tacctagaacatccagagaaggtgtttgaagttgagtga

DBGET integrated database retrieval system