KEGG   Thermococcus sibiricus: TSIB_1685Help
Entry
TSIB_1685         CDS       T00928                                 

Definition
(GenBank) Triosephosphate isomerase (TIM)
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00010  Glycolysis / Gluconeogenesis
tsi00051  Fructose and mannose metabolism
tsi00562  Inositol phosphate metabolism
tsi01100  Metabolic pathways
tsi01110  Biosynthesis of secondary metabolites
tsi01120  Microbial metabolism in diverse environments
tsi01130  Biosynthesis of antibiotics
tsi01200  Carbon metabolism
tsi01230  Biosynthesis of amino acids
Module
tsi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tsi_M00002  Glycolysis, core module involving three-carbon compounds
tsi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_1685
   00051 Fructose and mannose metabolism
    TSIB_1685
   00562 Inositol phosphate metabolism
    TSIB_1685
Enzymes [BR:tsi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     TSIB_1685
Exosome [BR:tsi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   TSIB_1685
  Exosomal proteins of bladder cancer cells
   TSIB_1685
  Exosomal proteins of melanoma cells
   TSIB_1685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG IGPS FMN_dh His_biosynth NMO NanE
Motif
Other DBs
NCBI-ProteinID: ACS90736
UniProt: C6A541
Position
complement(1520114..1520788)
Genome map
AA seq 224 aa AA seqDB search
MLEEPVIAINFKTYIEATGKRALKIAKAAEEVYKETGVTIVVAPQLADLYRIAQEVEIPV
FAQHIDPIKPGSHTGHVLPEAVKEAGAVGTLLNHSENRMILADLEAAIRRAEEVGLMTMI
CSNNPKVSAAVAALSPDYVAVEPPELIGTGIPVSKAKPEVITNTVNLVKKINPKVGVLTG
AGISTGEDVKKALELGTVGVLLASGVTKAKDPEKAIRDLVSLII
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgttagaggaaccagttattgccataaattttaaaacttacatagaagcgactggaaaa
agggctttaaagatagctaaagcagcggaagaagtctacaaagagactggtgtgactatt
gtggttgccccccagctggctgacctttataggattgctcaagaggttgagattccggtc
tttgcccagcacattgacccaataaagcccggcagtcatactggacacgtcttgccagaa
gcagttaaagaggctggagctgttggaactctgttaaaccactcagaaaacagaatgatt
ctagctgatttggaggctgcaatcagaagagctgaagaagttggcttaatgacaatgatc
tgttcaaacaatccaaaggtttcagcagctgttgctgcgttaagccctgattatgttgct
gttgaacctccagagcttataggaacgggaattccggttagcaaggcaaagcctgaggtg
attactaatacagtgaatcttgtgaaaaaaatcaacccgaaagtaggggttctaactggg
gcaggaatttcaacaggagaagacgttaaaaaagcattagaacttgggacagttggagtc
ttattggctagtggtgttacaaaggctaaagacccagaaaaagcaataagagatttggtg
tctttgataatttag

DBGET integrated database retrieval system