KEGG   Thermococcus sibiricus: TSIB_1686Help
Entry
TSIB_1686         CDS       T00928                                 

Definition
(GenBank) Glyceraldehyde-3-phosphate:ferredoxin oxidoreductase (GAPOR)
  KO
K11389  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
tsi  Thermococcus sibiricus
Pathway
tsi00010  Glycolysis / Gluconeogenesis
tsi01100  Metabolic pathways
tsi01120  Microbial metabolism in diverse environments
tsi01200  Carbon metabolism
tsi01230  Biosynthesis of amino acids
Module
tsi_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tsi_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tsi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TSIB_1686
Enzymes [BR:tsi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     TSIB_1686
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C Peptidase_M19
Motif
Other DBs
NCBI-ProteinID: ACS90737
UniProt: C6A542
Position
complement(1520831..1522795)
Genome map
AA seq 654 aa AA seqDB search
MRFSVLKVNLNEKSINLEDFEREGIYGIIDYALYLHDEVYKTYEAEDHYDPKNVMVFGKG
PFAGSILPGAHRMTFVYRSPQYGGVFPSTMGGAAYQFQRVGIDFVVLEGKREKPTVLILT
NDGEKLNVELHEIDFEKVIEIWRGYKGEEGVYALTQYLIDNFNDKFEGMEYRIACVGPAS
LNTNMGAIFSQTLRNGKRIVGSEDWAARGGTGSVLLRAHNVIAIIFGGKVRKKFPKEDIS
NVKIAKSIVEGVHKKPMNEVISENTVKYKYNPKLKTGGTFGGNYPAEGDFVPILNWQMPY
IPKEERVKIHENIMKYYWEPFNKEAIETKNWTNCGEPCPVVCKKYANGHHIEYEPREANG
PLSGVITLRASDVSVHAVDAMGFDAISFGGTVAWVLELVYRGLLKPDEVGLSDKPEFDKD
SLIMKPVETSEKNAKLVAELAHRVAFAENEIAKIIGEGIRRAAEILDEKFKDRLSYGESF
KDYGVYTPIGISGEMVPTMYWAIGNYIPLPIQGRYWTFYQFGVFLEPEELANRIIASALY
EYWYDNVGWCRFHRGWAKPVLKALFMEAYGENVDMEGQARKTMRKLVNYLKKAGYEPVFW
DSMRIIDLVAKGAEEFGNERWAEQFKKDKVVIAKEYLRRVLAEYSRILGVEWTL
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgaggttttcagtacttaaagttaacttgaatgaaaagagtataaatctggaggatttt
gagcgagagggaatttatggaatcattgactatgccttataccttcatgacgaggtttac
aaaacctatgaagctgaggatcattatgacccaaaaaatgtgatggtttttgggaaaggc
ccatttgctggttctatcctccctggagctcatagaatgacttttgtgtacagatcgcct
caatatggtggggttttcccttcaacaatgggaggggccgcctatcaatttcaaagggta
ggtattgattttgtggttctcgaaggaaagcgggagaaaccaacagtgcttattctcacc
aacgatggagaaaagttaaacgttgaacttcatgaaattgactttgaaaaagtgattgaa
atttggagaggctataagggggaggagggcgtttatgcactcactcaatacctcattgat
aactttaatgataagtttgagggaatggagtacaggattgcttgtgttggaccggcttct
ctgaatactaatatgggtgcgatattttcccaaaccctaagaaacggcaaaaggattgtt
ggaagtgaggattgggccgccagaggtggaactggaagcgttttattgagagcccataat
gtgattgccataatatttgggggaaaagtcagaaagaagttcccgaaggaagatataagc
aatgtaaagattgcaaaatccatagtagagggagtccacaaaaagccaatgaatgaagta
atatccgaaaacacagtgaaatacaagtacaatcctaagctcaagactggaggaactttt
ggaggaaactatccggctgaaggtgactttgtgccaatactaaactggcagatgccatac
attccaaaggaagagcgtgttaagatccacgagaacataatgaaatactactgggagccc
ttcaataaggaggcgatagagaccaaaaattggactaactgtggagagccctgtccagtg
gtgtgtaagaaatacgctaacggtcaccacatagagtacgagccaagggaagcaaacggt
ccgctcagcggggtgataactcttagagcgagtgatgtaagtgttcacgcggttgatgcc
atgggatttgatgcaattagctttggaggcactgtggcatgggttttggaacttgtttat
agaggattgctcaagccagacgaagttggcctaagcgataaacccgagtttgataaggat
agcttaattatgaaacctgttgaaaccagtgaaaagaacgccaaactcgttgctgaatta
gcccatagggttgcctttgctgaaaacgaaatcgccaagataattggagagggcataagg
agagccgctgaaatacttgatgagaagttcaaggataggctaagctatggagagagcttc
aaagattatggagtttatacacccataggaataagcggagagatggtacccacaatgtac
tgggctataggaaactacatacctctgccaattcaaggccgttactggacattctatcag
tttggagtgtttcttgagccggaagagttggccaataggataattgccagtgccctctat
gaatactggtatgacaacgttggctggtgtaggttccaccgtggatgggcaaagcccgtg
ttgaaagcactctttatggaagcctacggagagaacgtagacatggaagggcaggccaga
aaaacaatgagaaagctcgttaattatctcaagaaagccggctatgagccagtgttctgg
gattcaatgagaattatagatctggttgcaaagggtgcagaggagtttggcaacgaaaga
tgggcagagcagtttaagaaagataaagttgtgattgcaaaggagtaccttagaagggtt
ttagcagaatacagtagaatcttgggtgttgaatggacgttataa

DBGET integrated database retrieval system