KEGG   Thermococcus sibiricus: TSIB_1877Help
Entry
TSIB_1877         CDS       T00928                                 

Definition
(GenBank) PstA phosphate ABC transporter, permease protein
  KO
K02038  phosphate transport system permease protein
Organism
tsi  Thermococcus sibiricus
Pathway
tsi02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:tsi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    TSIB_1877
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tsi02000]
    TSIB_1877
Transporters [BR:tsi02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    TSIB_1877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ACS90926
UniProt: C5ZZU5
Position
complement(1688294..1689130)
Genome map
AA seq 278 aa AA seqDB search
MSGYKVRKLKEKVFLGLVGTLVVLMFLPLFHIVYSVFKNGIHVILNRGITFITGTLSEGG
IGPAILGTLFLTLLASLMGLSVGFFVGVYAYEYPKSILGRATKFLLQIMLEFPTILVGVF
VMQILVVPMGTYSTLAGALALAIIMIPYVAVYTHEAMRQIPFAYREAAFSLGVTRVKAVF
RILVPMAKRGILTGFLIGIAKVAGETAPLLFTVGGSYETYQIGIGKPVGAIPLLIYNLIQ
SPAREHHEIAWGASLILLLIFFGIFIPVRLSLREVRML
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggctataaggtaagaaagctcaaggaaaaggtgtttttaggtcttgttgggact
ttagtggtgttgatgttcctccctctctttcacatagtttacagcgtatttaagaatggt
atccacgtaattttgaatagggggataaccttcataaccggaacactttcagagggcggt
atagggcccgctattctcggaactctatttctgacccttcttgcctctctaatgggtctt
tcggttggtttttttgtaggggtatatgcctatgaatacccgaaaagcatacttggaagg
gcgaccaagttcctgctccagataatgctcgaatttccgacgatacttgtgggagtcttt
gtcatgcagattttggttgtcccaatgggcacgtactcaacccttgctggagcgttagca
ctggcgataataatgataccctatgttgcggtttacacacatgaagcaatgagacaaatt
ccgttcgcatatagagaagcagccttttcccttggagtaacaagagtaaaggctgttttt
agaatcttagtgccaatggcaaagagaggaattttaacgggtttcctcatagggattgct
aaggtagccggcgaaacggcgcctcttcttttcacggttggcggttcatatgagacatat
caaattggcattggaaagcccgttggagcaattccactattaatctacaacctaatccag
agtcctgcacgggaacaccacgagatcgcatggggggcatcgttgattctacttctgata
ttctttggaatattcatcccggtaagactcagcctcagggaggtgaggatgttatga

DBGET integrated database retrieval system