KEGG   Thermococcus siculi: A3L11_01525Help
Entry
A3L11_01525       CDS       T05103                                 

Definition
(GenBank) Na-dependent transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
tsl  Thermococcus siculi
Brite
KEGG Orthology (KO) [BR:tsl00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A3L11_01525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF1385
Motif
Other DBs
NCBI-ProteinID: ASJ07975
UniProt: A0A2Z2MK30
Position
complement(278897..279859)
Genome map
AA seq 320 aa AA seqDB search
MDALALAAIAVAFYIAWNIGSNDSANAMGTAVGAGILSFRQATLTIAIFVLMGAYLKGYK
VMKTVGKGIVPEGYLTMEMAVIALLAAGVWVTIATIKGLPVSTTQAIVGGVIGVGLATHA
PVNWYTLLKIAAAWVVSPVLSGILAMVLFKFYAWVVSRIKTVSTIEAMYKALAILGGSYM
AFNFGTNEVANASGPLVGAGFMEPKVAGIFGAISLSVGALTFSYAVMHTVGKKITALGPI
SAFAAQFGSAIAVSLANFFGLPVSSSQSIVGGVVGVGLLAGQGVEKSVIRDIVFGWVATP
LTAIFISLAIFKAFALVGLV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgcttgcgctggcagccattgcagtggcattctacattgcatggaacatcggt
tccaacgattcagccaacgctatgggaacggccgttggcgcgggcatactcagcttcaga
caggcgactctaaccatagctatcttcgtcctgatgggtgcatacctcaagggctacaag
gtcatgaagacggtcggcaagggcatagtccccgaaggctacctcacgatggagatggcc
gtcatagccctcctggctgccggcgtctgggttacgatagcgacgataaagggcctcccc
gtttccaccacccaggccatcgtcggcggtgtcatcggcgttggcctcgcaacccacgca
ccggtgaactggtacaccctgctcaagatcgcggccgcgtgggtggtttcccccgttctc
tcgggaatccttgcaatggtgctcttcaagttctacgcctgggtcgtctccaggataaag
actgtatcaacgatcgaggccatgtacaaggctttggccatactcggcggctcctacatg
gccttcaacttcgggaccaacgaggtcgcaaacgcctccggtccgctggtcggggccggc
ttcatggaaccgaaggttgccggcatcttcggggcaatatccctctccgttggtgccctc
accttcagctacgccgtcatgcacaccgttgggaagaagataaccgcgctcggccccata
tcagcctttgcggcccaattcggctcggccatagcggtgagcctcgccaacttcttcggc
cttccggtaagctcgagccagtcgatagttggtggcgtcgttggagtgggtctcctggcg
ggtcagggcgtcgagaagtcggtgataagggacatagtctttggctgggtggcgacgccg
ctaaccgcaatcttcatctctctggccatcttcaaggccttcgccctggtggggctggtt
taa

DBGET integrated database retrieval system