KEGG   Tsukamurella tyrosinosolvens: ASU32_01915Help
Entry
ASU32_01915       CDS       T05267                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
tsm  Tsukamurella tyrosinosolvens
Pathway
tsm00071  Fatty acid degradation
tsm00280  Valine, leucine and isoleucine degradation
tsm00281  Geraniol degradation
tsm00310  Lysine degradation
tsm00362  Benzoate degradation
tsm00380  Tryptophan metabolism
tsm00410  beta-Alanine metabolism
tsm00640  Propanoate metabolism
tsm00650  Butanoate metabolism
tsm00903  Limonene and pinene degradation
tsm00930  Caprolactam degradation
tsm01100  Metabolic pathways
tsm01110  Biosynthesis of secondary metabolites
tsm01120  Microbial metabolism in diverse environments
tsm01200  Carbon metabolism
tsm01212  Fatty acid metabolism
Module
tsm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tsm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ASU32_01915
   00650 Butanoate metabolism
    ASU32_01915
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ASU32_01915
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ASU32_01915
   00310 Lysine degradation
    ASU32_01915
   00380 Tryptophan metabolism
    ASU32_01915
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ASU32_01915
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ASU32_01915
   00281 Geraniol degradation
    ASU32_01915
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ASU32_01915
   00930 Caprolactam degradation
    ASU32_01915
Enzymes [BR:tsm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     ASU32_01915
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ASU32_01915
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     ASU32_01915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 ECH_2 3HCDH NAD_binding_8 NAD_binding_2 UDPG_MGDP_dh_N F420_oxidored 2-Hacid_dh_C AlaDh_PNT_C DAO adh_short_C2 GIDA NAD_Gly3P_dh_N Shikimate_DH ThiW
Motif
Other DBs
NCBI-ProteinID: AUN38922
Position
404840..407032
Genome map
AA seq 730 aa AA seqDB search
MSDNMIRWEQDADGIVTLTMDDPTSSANTMNELYGTSMRATVDRLEAEVESITGVVITSA
KKTFFAGGNLTEIRKATKADAQQVFDNVQEIKRDLRRLEKLPKPVVAAINGAALGGGLEI
ALAANHRIAADAKGSKIGLPEVSLGLLPGGGGVTRTVRMLGLQGALMGVLLQGTQMNPTK
AQQTGLVNEVVGTVDELLPAAKAWIKANPEGGVQPWDVKGHRIPGGSPIDKTLAPNAPAF
PANLRKQLKGAPMPAPEAIMAAAFEGTYVDFDTALEIESRYFTKLATGQVSKNMIKAFFF
DLQHINGGGSRPEGYDKYTAKKVGVIGAGMMGAAIAYVSAKAGIEVVLKDIDLDAAKRGK
AYSEQLEAKALAKGRTTQEKSDALLARITPTIDPQDFAGVDLVIEAAFESVEVKNKVFQE
IEDIVEPDAILGSNTSTLPITILAEGVKRQEDFIGIHFFSPVDKMPLVEIIRGAKTSDAV
LAKVIDYTLQIKKTPIVVHDSRGFFTSRVIGTFINEALAAIGEGVDPVYLEQAGQQAGYP
AAPLQLADELTLTLMQKIRLATETALKAEGKDVPQHGAFAVVDWMVENGRPSKKDGAGFY
DYAEGKRTGLSKGFQEHFKSGSTKPDFAELQERMLFIESIETVRCFDEGVMDSVADANIG
SIFGIGFPAWTGGVLQYINGYEGRPGTPAEGITGPKAFVAQANALAAKYGEQFTPPASLV
AKAEAGETYE
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaacatgatccgctgggagcaggacgccgacggcatcgtcacgctgacgatg
gacgacccgaccagctccgcgaacaccatgaacgagctgtacggcacgtccatgcgcgcc
accgtcgaccgcctcgaggccgaggtcgagtccatcaccggtgtcgtcatcacctccgcg
aagaagaccttcttcgccggcggcaacctgaccgagatccgcaaggccaccaaggccgac
gcgcagcaggtcttcgacaacgtccaggagatcaagcgcgacctgcgccgcctggagaag
ctgcccaagcccgtcgtggccgccatcaacggcgccgcgctcggcggcggcctcgagatc
gccctcgccgcgaatcaccgcatcgccgcggacgccaagggcagcaagatcggcctcccc
gaggtcagcctcggcctgctccccggcggaggcggcgtcacccgcaccgtccggatgctc
ggcctgcagggcgcgctcatgggcgtgctgctccagggcacccagatgaacccgaccaag
gcgcagcagaccggcctggtcaacgaggtcgtcggcaccgtcgacgagctgctccccgcc
gcgaaggcgtggatcaaggccaaccccgagggtggcgtgcagccctgggacgtcaagggg
caccgcatccccggcggctcgccgatcgacaagacgctggcccccaacgcccccgccttc
ccggccaacctgcgcaagcagctcaagggcgcgccgatgccggcgccggaggccatcatg
gccgccgcgttcgagggcacctacgtcgacttcgacaccgccctcgagatcgagtcgcgc
tacttcaccaagctggccaccggccaggtctcgaagaacatgatcaaggcgttcttcttc
gacctgcagcacatcaacggcggcggcagccggcccgagggctacgacaagtacacggcc
aagaaggtcggcgtcatcggcgccggcatgatgggcgcggcgatcgcgtacgtctcggcc
aaggccggcatcgaggtcgtcctcaaggacatcgacctcgacgccgccaagcggggcaag
gcgtactccgagcagctcgaggcgaaggcgctggccaagggccgcaccacgcaggagaag
tccgacgcgctgctcgcccggatcacccccacgatcgacccgcaggacttcgcgggcgtc
gacctggtgatcgaggccgcgttcgagtccgtcgaggtcaagaacaaggtcttccaggag
atcgaggacatcgtcgagcccgacgccatcctgggctcgaacacctccacgctgccgatc
accatcctcgcggagggtgtgaagcgccaggaggacttcatcggcatccacttcttctcg
ccggtcgacaagatgccgctggtggagatcatccgtggcgccaagacctcggatgcggtg
ctggccaaggtcatcgactacacgctgcagatcaagaagaccccgatcgtcgtccacgac
agccgtggcttcttcacctcgcgggtcatcggcacgttcatcaacgaggccctcgcggcc
atcggtgagggcgtcgacccggtgtacctggagcaggcgggccagcaggccggctacccg
gcggcgccgctgcagctggcggacgagctgacgctcaccctgatgcagaagatccgcctc
gccaccgagaccgcgctcaaggccgagggcaaggacgtgccgcagcacggcgccttcgcc
gtggtcgactggatggtcgagaacggccgcccgtccaagaaggacggcgcgggcttctac
gactacgccgagggcaagcgcaccggcctctcgaagggcttccaggagcacttcaagtcg
ggttcgacgaagccggacttcgccgagctgcaggagcgcatgctcttcatcgagtcgatc
gagaccgtgcgctgcttcgacgagggcgtcatggactccgtcgccgacgccaacatcggc
tcgatcttcggcatcggcttccccgcctggaccggcggcgtgctgcagtacatcaacggc
tacgagggccgcccgggcacgcccgccgagggcatcaccggcccgaaggccttcgtcgcg
caggcgaacgccctggccgcgaagtacggcgagcagttcaccccgcccgcctcgctggtc
gccaaggccgaggccggcgagacctacgagtag

DBGET integrated database retrieval system