KEGG   Tsukamurella tyrosinosolvens: ASU32_10290
Entry
ASU32_10290       CDS       T05267                                 

Definition
(GenBank) epimerase
  KO
K19974  2-epi-5-epi-valiolone 7-phosphate 2-epimerase [EC:5.1.3.35]
Organism
tsm  Tsukamurella tyrosinosolvens
Pathway
tsm00525  Acarbose and validamycin biosynthesis
tsm01100  Metabolic pathways
tsm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tsm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    ASU32_10290
Enzymes [BR:tsm01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.35  2-epi-5-epi-valiolone 7-phosphate 2-epimerase
     ASU32_10290
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: AUN40336
Position
complement(2117650..2118447)
AA seq 265 aa
MTRGRTASITVDVPQWRITDDLTAAAAIARSAAADGLQIDFGGAHRGPRLDQEDRLAEAR
RLASSIPVTALAVNHANDIGLVAEDGTPNPAATGLLRTALGCAVEIGIPVLHVPGFRRST
PSSPARVVGTAAVLRDVVDDAAVHGIAVAYESALDGPASIALADAVGRGSLGLVLDVGNL
VDAGHAPNAFAAAVGPRLHPCAHVKASAHDPATDPVPLLPRGLAIRSVLVENDYRSVPAR
LVADVAAVRDRLSQNPEGALCARSR
NT seq 798 nt   +upstreamnt  +downstreamnt
gtgacccgcggacgaacggcgtcgatcaccgtcgacgtcccgcaatggcggatcaccgac
gacctgaccgctgccgccgcaatcgcccggtccgcggcggccgacggcctgcagatcgac
ttcggtggagcccatcgcggtccgcgcctcgatcaggaggaccggctcgccgaggcgcgc
cggctggcctcgtcgatccccgtgaccgcgctggccgtcaaccacgccaacgacatcggc
ctcgtggcggaggacggaactcccaatcccgcagcgaccgggctcctgcgtactgcgctc
ggctgcgccgtggagatcggcatcccggtcctgcacgtcccggggttccggcggagcacg
ccgtcctcgcccgcccgcgtcgtcggcaccgccgccgtgctgcgggatgtcgtcgatgac
gctgcggtgcacggaatcgcggtcgcctacgagtccgcactcgacggccccgcgagcatc
gcgctcgccgatgccgtggggcggggttcgctcgggctcgtcctcgacgtcggaaacctg
gtcgacgccggacacgcaccgaatgccttcgccgcggccgtgggcccgcgtctgcatccc
tgcgcccacgtcaaggcctccgcgcacgatccggcgaccgatcccgtgcctctgctcccc
cgcggcctcgccatccgctcggtactcgtcgagaacgactaccgctccgtacccgcgcgg
ctcgtggccgatgtggccgcggtccgcgatcggctgtcacagaaccccgaaggagcccta
tgcgcgcgatcacgctga

DBGET integrated database retrieval system