KEGG   Candidatus Thioglobus singularis: W908_03165Help
Entry
W908_03165        CDS       T04071                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tsn  Candidatus Thioglobus singularis
Pathway
tsn00071  Fatty acid degradation
tsn00072  Synthesis and degradation of ketone bodies
tsn00280  Valine, leucine and isoleucine degradation
tsn00310  Lysine degradation
tsn00362  Benzoate degradation
tsn00380  Tryptophan metabolism
tsn00620  Pyruvate metabolism
tsn00630  Glyoxylate and dicarboxylate metabolism
tsn00640  Propanoate metabolism
tsn00650  Butanoate metabolism
tsn00900  Terpenoid backbone biosynthesis
tsn01100  Metabolic pathways
tsn01110  Biosynthesis of secondary metabolites
tsn01120  Microbial metabolism in diverse environments
tsn01130  Biosynthesis of antibiotics
tsn01200  Carbon metabolism
tsn01212  Fatty acid metabolism
tsn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tsn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    W908_03165
   00630 Glyoxylate and dicarboxylate metabolism
    W908_03165
   00640 Propanoate metabolism
    W908_03165
   00650 Butanoate metabolism
    W908_03165
  09103 Lipid metabolism
   00071 Fatty acid degradation
    W908_03165
   00072 Synthesis and degradation of ketone bodies
    W908_03165
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    W908_03165
   00310 Lysine degradation
    W908_03165
   00380 Tryptophan metabolism
    W908_03165
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    W908_03165
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    W908_03165
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    W908_03165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tsn04147]
    W908_03165
Enzymes [BR:tsn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     W908_03165
Exosome [BR:tsn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   W908_03165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALE01680
UniProt: A0A0M4LF30
Position
616611..617798
Genome map
AA seq 395 aa AA seqDB search
MNNEIVIVSATRTALGSFGGSLSSIPAHKLGSAVIASLLEKTGVANDQVDEVILGQVLTA
GSGQNPARQAALDAGLPNVTPAMTINKVCGSGLKAVQLAFQAIACGDAEIVIAGGQENMS
LSGHVLPKSREGKKMGPWEMVDTMVVDGLWCVFNDYHMGVTAENIASKFDYSRESQDHFA
SESQQKAESAQISDLFRNEITPITIPQRRGEDIVFDTDEFPRHGTTEESLSKLRPAFKKD
GTVTAGNASGINDGAAAVMVMSASKAKELGLKPMAKIVSYASAGVDPKIMGTGPIPASTK
CLEKAGWKASELDRIEANEAFAAQAMSVNDSLGLDKSKVNVTGGAIALGHPIGASGARIL
VTLVHGMERDKADKGLATLCIGGGMGVAMAVERLQ
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaataatgaaatagtaattgtttctgctaccagaacagctttaggttcttttggaggt
tcgctttcgtcaattccagcccataagttaggttctgctgttattgcctcattgctcgag
aagacaggagtagctaatgaccaagttgatgaggtaattttgggtcaagtgctgactgct
ggcagtggccaaaatccagctaggcaggcagctttagatgctggcctcccaaatgtgaca
ccagcaatgaccattaataaggtttgtgggagcggcttaaaggcagtacagctagcattt
caagctatcgcttgtggggatgctgaaatcgttattgcaggtggtcaagaaaatatgagt
ctttctgggcacgtcctaccgaagtcaagagaaggcaaaaaaatgggtccatgggagatg
gttgatacaatggtagttgatggtttgtggtgtgtatttaatgactatcacatgggcgtt
actgctgaaaatattgcttcaaaatttgactactcaagagaatctcaagaccactttgcc
tcagagtctcagcaaaaggcagagtctgctcagatttctgatttatttcgtaatgaaatt
acaccaattactattcctcaaagacggggagaagatatcgtttttgatactgatgaattt
ccaaggcatggaacaactgaggaatccttgtcaaagctaaggcccgcttttaagaaagat
ggaacagttactgcaggcaatgcatcgggtatcaatgatggagcagccgctgtaatggta
atgagtgcatctaaggcaaaggagcttggcttgaaacccatggccaaaatcgtttcttat
gctagtgctggtgttgacccaaaaattatgggaactggaccaatacctgcaagtactaag
tgtttagaaaaggctggctggaaagcttctgaacttgatagaattgaggctaatgaggca
tttgcagcgcaggccatgtccgtgaatgactctcttggtctggataagtctaaagtaaat
gttactggaggggctatcgcgttaggtcatccgattggtgcttcaggtgctagaatttta
gtaacacttgtgcatggcatggagcgtgataaagcagataaaggtctcgctactctttgt
attggtggaggaatgggtgttgctatggctgttgaaagacttcagtag

DBGET integrated database retrieval system