KEGG   Trichinella spiralis: Tsp_01469Help
Entry
Tsp_01469         CDS       T01609                                 

Definition
(RefSeq) myotubularin
  KO
K18083  myotubularin-related protein 6/7/8 [EC:3.1.3.64 3.1.3.95]
Organism
tsp  Trichinella spiralis
Pathway
tsp00562  Inositol phosphate metabolism
tsp01100  Metabolic pathways
tsp04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Tsp_01469
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    Tsp_01469
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tsp01009]
    Tsp_01469
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.64  phosphatidylinositol-3-phosphatase
     Tsp_01469
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     Tsp_01469
Protein phosphatases and associated proteins [BR:tsp01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    Tsp_01469
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related 3-PAP GRAM Y_phosphatase HTH_29
Motif
Other DBs
NCBI-GeneID: 10911475
NCBI-ProteinID: XP_003377307
Position
Unknown
AA seq 714 aa AA seqDB search
MRPSDIIKIPKCVMGADKAAFSDIAYIKVENVEWCDCQPNMSQRGTLYITNTHMIFASED
GKELWISHCQISSLQRAQPVDSGWPLIISGKIFFALTMIIPKERDCQDIYDSLLALSRPT
CIDDLPAFCFVPEMKDLMQSEGWNEINMYDDYARLGLPNDNWTISDLNKNFEYCDGYPER
IFVPKNVPTPVLIGSSKFRSRGRLPVLSYLHRTNQACICRCSQPLAGFSARCIEDESLMR
HIAKTNPHSKTLYIVDTRPKINAIVNKAAGKGFEDERNYSHVRYHFFAVENIHAVRGSLQ
KMLEVVWNKKNVSVSNFLTGLVNSGWLKHIRSLLETAVFVSETVISGTSVVIHCSDGWDR
TPQIVSLSCILLDPFYRTIKGFEVNQLKTTLIEKEWLQFGHKFSDRYGHIYTSDSKELAP
VFTQFLEAVWQLTVQYPLEFEFNEFFLLTLHDHLHSCNFGTFLYNSTKDRIQSKVSSRTY
SLWGYMSRLEESLRNPLYDPSDIKDILKPDLRPQQINYWRAMYNRYDFKCDSNEYLLDAL
ISSRQQILSLKYHIQYLQDQLNQQREASFQQCCLKFSNLLPKNSSSTDDNNCAVNGTLVA
EHCEIHKMSISANSDENDEEKNLETFSHPLSAAVSCENKADNEINVPLIDQRCAIALDWA
SLRRSVRCSNRTCNAKFWPLERRCHCWNCGLLENSTPGAWKLRSNGTSLCEMHN
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccttcggatattattaaaattccaaaatgtgttatgggagctgacaaagctgcg
ttttctgatattgcttatattaaggtggaaaatgttgaatggtgcgattgccaaccgaat
atgtctcagcgtggaacgctgtacattacgaacacccatatgatttttgcatctgaagat
ggaaaagaactttggatttcccattgtcagatctcatctctgcaacgagcacagcctgtt
gacagtggttggccgcttattatttctgggaaaatattctttgctctaacaatgatcatt
cctaaagagcgagattgtcaagacatatacgattcacttttggcgttgagtcgtcccaca
tgcattgacgatttgccagctttttgttttgtacctgaaatgaaagatttgatgcaaagt
gaaggctggaacgaaattaacatgtatgacgattatgctcgactgggattgccgaatgat
aattggacaattagtgatttgaacaaaaattttgaatattgtgatggttatccagagcga
atttttgttccgaaaaacgttcccacgccagtgcttattggttcttcgaaatttcgaagc
cggggtcgtttgccagttctatcatatttgcatagaacaaatcaagcttgcatatgtcgc
tgcagtcaaccgttggctggtttcagtgccagatgcattgaagatgaaagtctgatgcgg
cacattgccaaaaccaatccacattcgaaaacgctttacattgtcgacacaaggccaaaa
atcaatgccattgttaacaaagctgctggcaaaggttttgaagatgagcgtaattacagc
catgtacgttaccatttttttgctgtagaaaatattcatgctgttcgaggtagtttgcaa
aaaatgctggaagttgtgtggaataagaaaaatgtctctgttagcaactttttaacagga
ttggtcaacagtggttggcttaagcatattcgctctttgcttgaaactgctgtttttgtc
agtgaaaccgtgatttctggaacaagtgtagtaatccattgttcggatggttgggatcgg
acgccacagattgtcagtctctcttgtattctattggaccctttttatcgcactatcaaa
ggctttgaagtaaatcagttgaagacaacattgatagagaaagaatggctgcaatttgga
cacaaattttccgatcgatatggtcacatttatacatctgattcgaaagagctggcaccg
gtatttactcaatttctggaagctgtctggcaattgactgtacaatatccgctggaattt
gaattcaacgaattctttctgcttactttacacgatcatttgcattcgtgcaattttggt
acttttttgtacaacagcacgaaagatcgaatccagtcaaaagtttcctcacgaacttat
tcactttggggttacatgtctcgtctggaagaatctcttcgcaatccattgtacgacccg
tcagatatcaaagatattttgaaaccagatttacgacctcagcaaataaattattggcga
gcaatgtacaatcgatatgacttcaaatgtgactctaatgaatacttattggacgctttg
atttcttccagacagcagatactttctttgaaataccacattcagtatttgcaagaccaa
ttgaatcagcagcgtgaagcaagtttccaacagtgctgtttgaaattttcaaatttgctg
cccaaaaactcttcctccaccgatgacaacaattgtgcggtaaacggcacgcttgtggct
gagcactgcgaaatccacaaaatgtcgatttcggcaaacagtgacgagaatgatgaagaa
aaaaatttggaaaccttttcccaccctttgtcagcagcagttagttgtgaaaataaagct
gacaatgagataaatgttcctctgatagatcagcgatgtgccattgctttggactgggcc
agcttgcgtcggtctgttcgttgtagcaatagaacttgcaacgccaaattttggccttta
gaacgtcggtgtcactgttggaactgtggactgctcgagaactcaactcccggggcatgg
aaattgcgatcaaatggtaccagcctgtgcgaaatgcataactaa

DBGET integrated database retrieval system