KEGG   Trichinella spiralis: Tsp_01933Help
Entry
Tsp_01933         CDS       T01609                                 

Definition
(RefSeq) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
tsp  Trichinella spiralis
Pathway
tsp04068  FoxO signaling pathway
tsp04146  Peroxisome
tsp04212  Longevity regulating pathway - worm
tsp04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    Tsp_01933
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    Tsp_01933
 09150 Organismal Systems
  09149 Aging
   04212 Longevity regulating pathway - worm
    Tsp_01933
   04213 Longevity regulating pathway - multiple species
    Tsp_01933
Enzymes [BR:tsp01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Tsp_01933
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 10907148
NCBI-ProteinID: XP_003377741
UniProt: E5SDW9
Position
Unknown
AA seq 258 aa AA seqDB search
MVSFFLKSVPASCLRCLRKKHTLPDLPYDFGALEPYISAEIMRLHHQKHHATYVNNLNIA
EEKHKEALAKKDTTAAIALQPALRFNAGGHINHTPKSGGMPVGKLAQAITNNFGSFDIFK
ANLTAACIGVQGSGWAWLGYDANMKRLQIATCANQDPLQATTGLIPLLGIDVWEHAYYLQ
YKNVRGDYVKAIWEVINWNDVQQRFADAVGSALFHEKVKQTDIAQLYTMRFCKTFDCKNK
KKGERSSCSTAALTLCGT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atggtgtcgttttttctgaaatcggttcctgcaagttgcttgcggtgcctgcgtaagaag
cacacgttgcccgatttgccatatgacttcggtgctctggaaccgtacatatcggctgaa
attatgcgactgcatcatcagaagcatcatgccacctacgtgaacaatttgaacattgcc
gaagagaagcataaagaagcgctggcgaaaaaagatactactgctgcaatagcgcttcag
ccggctcttcgtttcaacgccggtggtcacattaatcacactccgaaaagtggcggcatg
cctgttggaaaactggcgcaggcgattacgaacaatttcggttctttcgacatattcaaa
gcgaatctgaccgccgcgtgcattggtgtgcagggttccggttgggcatggctgggctac
gatgctaacatgaaacggctgcagattgccacttgtgcaaatcaagatccattacaagcg
actactggtctgattccactgctcggcattgatgtgtgggaacatgcgtattatttgcag
tacaagaatgtccgaggggattatgtaaaagcaatttgggaagttatcaattggaacgat
gtgcaacagcgatttgcagacgctgtgggctctgctttatttcatgaaaaagttaaacag
acagatatagcacaattgtatactatgcgtttctgcaaaacattcgactgtaaaaataaa
aaaaaaggtgaacgctcatcttgtagtacagcagctttgacactttgcggaacgtag

DBGET integrated database retrieval system