KEGG   Trichinella spiralis: Tsp_02253Help
Entry
Tsp_02253         CDS       T01609                                 

Definition
(RefSeq) beta-hexosaminidase subunit alpha
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
tsp  Trichinella spiralis
Pathway
tsp00511  Other glycan degradation
tsp00520  Amino sugar and nucleotide sugar metabolism
tsp00531  Glycosaminoglycan degradation
tsp00603  Glycosphingolipid biosynthesis - globo and isoglobo series
tsp00604  Glycosphingolipid biosynthesis - ganglio series
tsp01100  Metabolic pathways
tsp04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tsp_02253
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    Tsp_02253
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    Tsp_02253
   00604 Glycosphingolipid biosynthesis - ganglio series
    Tsp_02253
   00511 Other glycan degradation
    Tsp_02253
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    Tsp_02253
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Tsp_02253
Chaperones and folding catalysts [BR:tsp03110]
 Intramolecular chaperones
  Others
   Tsp_02253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 Glycohydro_20b2
Motif
Other DBs
NCBI-GeneID: 10907813
NCBI-ProteinID: XP_003378067
UniProt: E5SET7
Position
Unknown
AA seq 534 aa AA seqDB search
MRLFTLYFIVLLNTGFVKLSFSKFISNRTYGIPWPMPYEFTLDNRNFSLAQESFKFYTTY
SCDILNNAMQFYRKILFPPSGSTTDVTSELLPFTTLKIVVHIPCPPDYPPSNMIENYTLS
LWPNGTGLLESLQVWGALRGLETFSQLVIPADPDEHTTAMLRSANINDSPRFPHRGILLD
TSRHFVPVDVIKTQLELMAQNKFNVFHWHIVDDPSFPYQSDSFPNLSNKGAFSNQRIYKK
IDILKVINYARLWGIRVIAEFDTPCHVQSWADAMENLTSSCDISHLHFNPLTGSLDPTRP
ETYSFMKTLLQEVFSDFPDEHFHLGGDECDLGCWDYNWAIRTFKKEMNFTTLKEVQGYYL
NKLLDLVMEIRPNTTPILWEDGLSDSIKYSDKLIIQMWLGNTRNEQRSRLANVTARGYRA
LVSSCWYLNIIKYGIDWPGYYDCDPRDFNGTVEQKSLVLGGEACMWGEHVDSSNLTPRLW
PRAAAVGERLWSTEMKRNESTTERLENHRCRLLARGYTVEPVNGPGYCYEVAKL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgagattgttcactttgtacttcattgttttgctgaatacgggcttcgtgaagctatca
ttctcaaagttcatttccaatcgcacttatggcattccgtggccaatgccttatgaattt
acgttggataatagaaatttttccctggcacaggaaagtttcaaattttacactacttat
tcctgcgatattttaaataatgccatgcaattctatcgtaaaatactgttccccccttca
ggtagcactactgatgtaaccagtgaacttttaccattcacgacgctaaaaattgttgtg
cacattccttgtccacccgactatccaccgtcaaatatgatagaaaattacacgctttcg
ctatggccaaatggcacaggtcttttggaatcgttgcaagtatggggtgccctcaggggt
ctggaaacgttcagtcagctggtgattcctgctgaccccgatgaacacaccacagccatg
ctgagatctgcaaatattaatgattcacccagatttcctcatcgtggaattcttctggat
acatctcggcatttcgttccagttgatgtgatcaaaacccagcttgaactgatggcgcaa
aataagttcaacgtctttcattggcatatcgtcgatgatccgtcatttccttatcaaagc
gatagttttccaaatttgtccaacaaaggtgcattttcaaatcaaaggatatataagaaa
attgacattttgaaagtaataaattatgcccgtttgtggggcatacgtgtgattgccgaa
tttgatacaccttgtcacgttcagtcttgggcagatgcaatggaaaatttgacatcatcc
tgtgatatttcccatcttcactttaatcctctgacgggcagtttggaccccacaagaccg
gaaacgtactcatttatgaaaactttgctccaggaagtattcagtgattttccagatgaa
cacttccatcttggcggcgacgaatgcgacttaggctgttgggattataactgggctata
agaacgttcaaaaaggaaatgaatttcactactttgaaagaagtgcaaggttactatttg
aacaagttgctcgatttggtgatggaaattagacctaatacaacacctattctttgggaa
gatggtttgagtgattcgataaaatattcagataaactgatcatccaaatgtggcttggc
aatacaagaaatgagcaacgttctaggctagcaaatgtaactgcccgtggttatcgggcc
ttggtttctagctgttggtatttgaatatcatcaaatatggtatcgactggcctggatat
tacgactgtgatccaagagattttaatggaactgttgagcagaaatctttggtcctcgga
ggtgaagcttgcatgtggggtgaacatgtggacagttccaatttaactcctcgactttgg
ccaagagcagctgcagtcggagagcgattgtggagcacggaaatgaaaagaaatgaatcg
acaactgagcgattggaaaatcatcgctgccgtctcttagccaggggctacactgtggaa
cctgttaacggtcctggatattgctacgaagttgcaaaattgtga

DBGET integrated database retrieval system