KEGG   Trichinella spiralis: Tsp_02272Help
Entry
Tsp_02272         CDS       T01609                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K05361  phospholipid-hydroperoxide glutathione peroxidase [EC:1.11.1.12]
Organism
tsp  Trichinella spiralis
Pathway
tsp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Tsp_02272
Enzymes [BR:tsp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.12  phospholipid-hydroperoxide glutathione peroxidase
     Tsp_02272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 10907794
NCBI-ProteinID: XP_003378049
UniProt: E5SEV5
Position
Unknown
AA seq 129 aa AA seqDB search
MASKSSDKCVYDFEAKDIDGNGLRIAAFPCNQFGKQEPKSEEEIKKFATERYGVTFDMYS
KIDVNDANEHPLWHFLKSKLSGTTGTPIKWNFAKFLIDQNGVPVRRYEPDDSPNSMEPDF
VALLNKKDS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaaaagcagcgataaatgcgtttacgattttgaagcaaaagacatcgatgga
aatggcttacgtattgctgcattcccatgtaatcaattcggaaagcaggaaccaaaatca
gaggaagaaattaaaaaatttgcaacagaacgttatggagtaacatttgatatgtattca
aagattgacgtgaatgatgcaaatgaacatccattatggcattttttgaagtccaaactg
agcggaactactggaacgccaattaaatggaattttgcaaagtttctgattgatcaaaat
ggtgttccagttcgacgctatgaacctgatgattcgccaaacagtatggaacctgatttt
gtagccctgttgaacaaaaaagattcataa

DBGET integrated database retrieval system