KEGG   Trichinella spiralis: Tsp_03596Help
Entry
Tsp_03596         CDS       T01609                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
tsp  Trichinella spiralis
Pathway
tsp04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    Tsp_03596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 Dehyd-heme_bind
Motif
Other DBs
NCBI-GeneID: 10910071
NCBI-ProteinID: XP_003379947
UniProt: E5S446
Position
Unknown
AA seq 108 aa AA seqDB search
MSQIPKGDPEKGKKLFVQRCAQCHTVEKGGGNKTGPNLNGIVGRKSGQVPNFDYTAANKN
KGVIWTREALFEYLLNPKAFIPGTKMIFAGLKKESDRADLIAYLEQNS
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaataccgaaaggtgacccggaaaaaggtaaaaagctttttgttcaacgatgc
gctcaatgtcacacggtggagaaaggtggaggtaacaagactggacccaatttaaacggt
atcgttggtcgcaagagtggtcaagtgccgaatttcgactataccgctgccaataagaac
aaaggagtcatttggacccgtgaagctttgttcgaatatttgctaaacccaaaggctttt
attcctggtacaaaaatgatttttgccggtttgaaaaaagagagcgaccgtgccgactta
attgcctacttagagcagaattcgtga

DBGET integrated database retrieval system