KEGG   Trichinella spiralis: Tsp_04710Help
Entry
Tsp_04710         CDS       T01609                                 

Definition
(RefSeq) putative clathrin heavy chain 1
  KO
K04646  clathrin heavy chain
Organism
tsp  Trichinella spiralis
Pathway
tsp04142  Lysosome
tsp04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tsp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Tsp_04710
   04142 Lysosome
    Tsp_04710
Membrane trafficking [BR:tsp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    Tsp_04710
Exosome [BR:tsp04147]
 Exosomal proteins
  Proteins found in most exosomes
   Tsp_04710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Clathrin_propel Clathrin-link Clathrin_H_link Coatomer_WDAD TPR_7
Motif
Other DBs
NCBI-GeneID: 10912567
NCBI-ProteinID: XP_003369291
UniProt: E5SVW3
Position
Unknown
AA seq 1447 aa AA seqDB search
MTTSLPIRFQEHAQLQNLGISASNIGFSTVTMESDKYICVKEKVGDSAQVVVIDLNDISN
PMRRPISADSVIMNPVSKVLALKAGKMLQVFDIDVKSKVKSCQFSEEVVFWRWLDVNNIA
LVSPTSVYHWTMESESVPVKMFDRMQSLSDRRIINYKADSKYMWLLLMGIFGKNEEPSTL
FSFASRQQAFAKLHIVEVGTASGKNATYTKKVVDLFFPAEGQHDFPIAMQGSEKHGVIFI
ITKCGYIHVYDVEFAVCIYMNRISNETIFVTTEYQLTSGILGITTKGQVLSVSIDEQNVI
PYITNTLQNPDLAMRFAARCDLPGAEDLFVRKFTTLFNEQRYSEAAEIAAVAPKLECSEE
LGDLIQAQGKDTTLALSVYLRSHCHPKVILCFAETGSFDKILLYAKRVGYQPDYVFLLRQ
VIQKSGPEKAVEFARMLIKDEERPLADLNQIADCFLEVNLVPQCTAFLLDALKNDRPSEG
PLQTRVLEINLLTNPAVADTILQQNIFHHYDRAHIAQLCEKVSLMQRALEHYTDLYDIKR
AVVNTQSLNLDAACRTGQIKEVERICRESTFYEPERVKNFLKEAKLTDQLPLIIVCDRFD
FVHDLVLYLYQNNLHKYIEVFVQKPWLETKVHEGATDAATHNAIAKIYIDSNNNAERFLR
ENPYYDSRVIGKYCEKRDPHLACIAYERGHCDTELINVCNENSLFKNLSRYMVCRRDSEL
WNQVLQESNPYRRQLIDQVVQTALSETQDPDDVSVTVKAFMAANLPNELIELLEKIVLDN
GLFSEHRNLQNLLILTAIRADRPRVMEYVQRLENYDAPDIANLAITSELYEEAFAIYKKF
DVNTSAIKVLIDNIGNLDRAYEFAERCNESGVWAQLAAAQLRHNMVKEAVDSFIKADDAS
YYVEVVQTCSKTDHWEDLVRYLKMARKKARESFIDTELVFAFAKTKRLAEMEDFVTGPNH
AQILQVGERCFDEGMYDASKILFNNVSNFAKLAITMVRLGEYNGSVDAARKANSTKTWKE
VTVVELLKIAIYLYVQFVPQVCYACVDAEQFQLAQTCGLHIVVHAEELEELNTYYQQRGY
FEELINLLEAALGLERSHMGIFTELAILYSKYKPEKMREHLELFWSRVNIPKVLRAAEQA
HLWAELVFLYDKYEEYDNAVVTVMKHPVEAWREQHFKEIITKVANIELYYKAMQFYLDYK
PLLLNDLLTVLAPRMDHTRAVAFFTKNKHLPLIKPYLRAVQNQNNKAINEALNQLLIEEE
DYAGLRASIDAFDNYDNIALAQQLEHHELIEFRRISAYLYKGNNRWKQSVELCKKDKLYK
DAIEFAAESRQSELAEDLISYFLENNLKECFAATLYQCYDLLHPDVILELAWRHDLMDFA
MPYMIQVLRELTTTLMLTYGMNAPAVAMPHQQQQQQQSAQPGSAAAYSTNAYLGSALYSS
YPGYRMP
NT seq 4344 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatctctacctattcgatttcaagaacatgctcagctgcaaaatctgggcatc
agcgcttctaacatcggtttcagtactgtgacaatggaatcggataaatacatttgcgtt
aaagaaaaagtgggagattctgcccaagtggtcgtaatcgatttgaatgacatcagcaat
cctatgcgaagaccgatttctgcggattcagtaattatgaacccagtttcaaaagttctg
gctttgaaagcaggaaaaatgctccaagtattcgacatagatgtgaaaagcaaagtgaaa
tcatgtcagttttcggaagaagtagtgttttggagatggcttgatgtgaataatattgca
ttggtttcgccgacatcagtttatcactggacgatggaaagtgagtctgttccagtgaaa
atgttcgatagaatgcagtcgctcagtgatcgtcgaattatcaattacaaagcagatagc
aaatacatgtggcttcttttgatgggcatatttggcaaaaatgaagaaccaagcacgttg
tttagttttgcctcgcgacagcaggcttttgcaaagctacacatagttgaagttggaact
gcatctggtaaaaatgcgacgtataccaaaaaagtggttgacttgttttttccggcagaa
ggtcagcatgattttcccatcgcgatgcagggaagtgaaaagcatggtgtgatttttatc
attacaaaatgtggttacattcatgtttatgatgtggaattcgcagtttgtatttatatg
aatcgaatttcaaacgagacaatcttcgtgacaactgaataccaattaacatctggaatc
cttggcattactacgaagggtcaggtgctaagcgttagcattgacgaacagaatgtcatt
ccatacataacgaatacattgcaaaatccggatttagctatgcgttttgcagctcgatgt
gatttgccaggtgccgaagatttgtttgtacgcaagtttaccactctcttcaacgaacaa
agatatagcgaagcagcggaaattgctgcagtagctccaaaattggagtgcagtgaagag
ttgggcgatttgatccaagcacaagggaaagatacgacgttggcgttgtcggtgtatttg
cgttctcactgccatccaaaagttattttgtgctttgccgaaactggcagttttgacaaa
attcttttgtatgcaaagagagttggctatcagccggattatgtgtttctattgcggcaa
gtgattcagaaaagtggaccggaaaaagctgtcgaatttgcacgtatgttgattaaagac
gaagaaagacctttggcagatttgaatcagatagcagattgctttttggaagtaaatctc
gttcctcagtgtactgcatttttgttggatgctttgaagaatgatcgaccgtcagaaggt
ccactacaaacacgcgtgttggaaattaatcttttgacaaatccagcagttgccgataca
attctccagcagaatattttccatcattacgatcgtgcgcacattgcgcagttgtgtgaa
aaggtttcactgatgcaacgtgcactggaacattacacagatttgtacgacatcaaacgg
gctgtggtcaatacccagtctttgaatttggatgcagcttgtcgcactggacaaatcaaa
gaagtagagaggatttgtcgtgagtcgaccttctacgaaccggagcgtgtgaaaaatttt
ttgaaagaagcgaaacttactgatcaactccctttgattattgtctgcgatcggttcgac
tttgtccacgatcttgtactctacttgtaccagaacaacttgcacaaatatattgaagtt
tttgtgcagaagccgtggttggagactaaagttcacgaaggtgccaccgatgctgccacg
cacaacgctattgcgaaaatttacattgatagcaataacaatgccgagcgtttcttgaga
gaaaatccctattacgattcgcgggttattggaaaatactgcgaaaagcgtgatccacat
ttggcttgtattgcctacgaaagggggcactgcgatacggaactgatcaacgtttgcaac
gagaattcgttgttcaaaaatttatcccgctacatggtctgtcgcagggacagtgaactg
tggaaccaagtgctgcaggagagcaacccgtacagacggcagttgatcgaccaagtggtg
cagaccgcgttgtccgaaactcaagatccggacgatgtgtcggtgacggtgaaagcgttc
atggctgccaatttacccaacgaactgatcgaattgctcgagaaaattgtcctggacaac
ggcttattttccgaacatcgcaatttgcaaaatttgctcattttgaccgcaatccgagcc
gaccggcctcgtgtgatggaatacgtccaacggttggaaaattacgacgcgccggatatt
gccaacttggcaatcacatccgaattgtacgaagaagcatttgcaatatacaaaaagttc
gacgtcaacacatcggctataaaggttttaatcgacaatattggcaatttggaccgtgct
tacgagtttgccgaacgttgcaacgaatctggcgtttgggctcagttggccgcggcgcag
cttcgtcacaatatggtcaaagaggctgttgattctttcatcaaagctgacgacgcttct
tattacgtggaagtggttcaaacttgcagcaaaacagatcactgggaagatttggtgcgc
tatttgaaaatggccaggaaaaaagcacgcgaatcgttcattgataccgaattggttttc
gcatttgccaaaaccaaacgtttggccgagatggaagatttcgtcacaggaccgaatcat
gctcagattttacaagttggggaacgttgttttgacgaaggcatgtacgatgcgtcgaaa
attttattcaacaatgtcagtaattttgccaaactggcgatcacgatggtacgtcttggt
gaatacaatggatctgtcgatgcggcaagaaaggcaaattcgaccaaaacttggaaagag
gtaacagtagtagaactgttgaagattgcaatttatctgtatgtacaatttgtcccacag
gtgtgctatgcgtgcgtggatgcggaacaattccaactggcccaaacatgcggattgcac
attgttgtccacgccgaagagctcgaagaattgaatacttattatcaacagcgtggctat
tttgaagagttgatcaatttgctcgaagctgcattgggattggaacgttctcatatgggc
atttttaccgaacttgcaattttgtattcgaaatataaaccggaaaagatgcgtgaacat
ttggaattgttctggtcaagggttaatattccgaaagtgttgcgcgccgctgaacaagcc
catctgtgggcagagttggtcttcttgtacgacaaatacgaagaatacgacaacgccgta
gttactgtcatgaagcatccagtagaagcttggcgtgagcagcatttcaaagaaatcatc
accaaagtggcgaacattgaactctattacaaggcgatgcaattttaccttgattacaag
ccgttactgttgaatgatctgctgaccgtcctggctcctcgtatggatcatacgcgagct
gttgcattttttacaaaaaacaaacatctaccactgataaagccctacctgcgagcagtg
caaaatcagaacaacaaagctataaatgaagcgttgaatcaactgttgattgaagaagaa
gattatgctggtcttcgtgcttctattgatgcatttgacaactatgataacattgctctg
gctcagcagcttgaacatcatgaactgattgaattccgtcgcatcagtgcttacttgtac
aagggtaacaatcgctggaagcagtctgtcgaattatgtaaaaaggataaattgtacaag
gatgcaattgaattcgcagcagaatctcgccaatcagaacttgcggaagatttgatctct
tactttttggagaacaatttgaaagaatgctttgcagcgactctttatcagtgttacgat
ttgctgcatccggacgtgattttggaactggcatggagacatgatctgatggatttcgcg
atgccttatatgattcaagttcttcgcgaactcaccactacgttgatgttgacttatgga
atgaatgccccggctgttgcaatgccccatcaacaacagcaacaacaacagtctgcacag
cctggttcagcggcagcgtattctacaaatgcatacttgggttctgccctgtattccagc
tatcccggttatcgtatgccatag

DBGET integrated database retrieval system