KEGG   Trichinella spiralis: Tsp_05497aHelp
Entry
Tsp_05497a        CDS       T01609                                 

Definition
(RefSeq) putative anion exchange protein
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
tsp  Trichinella spiralis
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tsp04131]
    Tsp_05497a
Membrane trafficking [BR:tsp04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    Tsp_05497a
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 MBOAT zf-MYST
Motif
Other DBs
NCBI-GeneID: 10913302
NCBI-ProteinID: XP_003371837
Position
Unknown
AA seq 1431 aa AA seqDB search
LEAFGSAPVAIFRQAALRCCSQRAPSPSPSVSSRSSAGSTAAAGTTTGGGCWSSSSAGSS
SAPAAASGAIGSAELTVDFRSRHFLVGLVLSALASTLEWNVDSSQAAAVALLANLLRAHD
SDRRLDDRSTKSRAASLYFPLLGVVMDARARLHDPARANDPDPDVTMRMIATGLVQFAGS
GTIASVPGCDDHAPSADVVAADSVDADNHRARLLLTLDTTRNLLLCFCWVIKNIEASAFR
QWLSELPAARIGHFIDALHVCVSCFEYKGQQRRRQRHQQRQPAKGGAVALEQSFDDGQLS
AEVNLIVLDAFEWICKTAVSSECLVSAGSGPGVLGAALRLLLHMLSCNQSVLVLGQLFAS
QRAFVEKYPEIVFDEQVDQCSQLCLQLLRHCASAVAEVRAQAAASLYLLLRRAFESALVN
FSRLKMQITVSLSSLVGGAWFSVDRLRGSLGTVLACVDQADQADTAAVQWSAFVDQAKEL
VENLNAILADTAKMEECQQDFEMLTDLIYRIAKGYRRSPDLRLAWLQNLTQKQLERGHHA
EAAMCYVHAAALVSEWGRASGDAPHYWPKGAVAFLALSENVLEESAAWEVDAFAGSDRDW
EPRLPGRQFSEAGLCGLLEQAAQLFYQASMYELMHGAFKLILPVLERRRDYRRIGLVYGR
LADALSRIDDRGPNSDKRLFGTYFRVGFYGAKFADLDGLEYVYREPAITKLSEISSRLES
FYADRFGAGSVEVIKDSNNVDPARLEPHKAYLQITYVEPYFDRWELRRRVTVFERNHNVS
RFVYATPFTLDGRAHGELGEQYKRKTVLTTSHSLPYMKSRVLVVHKEQSVLTPVEVAIED
INKKTLELELATGQQPPDGKILQMVLQGCIGTTVNRGPLEIANVFLGEQQPVNGAAGAGA
GSSTTATTANAGEPVSEVLQNRLRLSFKDFSKKCADALRENKRLIGPNQREYQKELERNY
LHFTEQLTPILSSVPNDRQDNLLITNCPRWSLPFCNTAVGYTTAQLALVCHLLLPPLPSG
LTGTCFTDDYYLKKLLFNMSTTGLFSASQGLSDPAICLLASLICGMHTIHSLISIFVAYI
LCRYFKGTIDSVVIAFVFFMSYLVIGYNVMSSGKYDLSWTMPQCVLTLRLIGLIVDLYDG
MQPKEKLSAYQLEARVDDSPDLLEIAAFSYFFGGCFVGPQKLINNSADGYSADFCLFFAF
QFPLNRFRRFVDGAYNDAETGGPPKRFDELQLVGKILKMEISILSILSVFPAMLRLFAGL
VYGELFIFVEIGLHPVLVPICGTSLSVGMADCACGNAESASAAEGQTAKFGSDLLAAVVR
QKVRGAALLRVRLLAVRFAYYRQVVENCILLFAFSLSQVYKSVYFFGWVMYGIVWPLIVV
SYWSTHGWRRSKAGNGTIPSKENAQVNKSNGADGRNVHQNVDNAINKAKIN
NT seq 4296 nt NT seq  +upstreamnt  +downstreamnt
ttggaagcgttcggctcggcgccggtggccatattccgccaagcggcgttgcgctgttgc
agccaacgggctccatctccgtcgccgagcgtgtcgtctcgttcgagcgccggttcgacc
gccgccgccggcaccaccactggcggcggatgttggtcttcgtcgtcggcgggctcgtcg
tcggcgccggcggcggcctctggagcgatcggctccgccgagttgacggtcgacttccgc
agtcggcactttttggtcggcttggtgctgagcgccctggcgtcgacgttggagtggaac
gtcgactcgtcccaagcggccgcggtggcactgctggcgaatttgctgcgcgcccacgac
tcggaccgccgactcgacgaccgttcgaccaagagccgcgcggcgtccttgtacttcccg
ctgttgggcgtggtgatggacgcgcgggcgcggctccacgacccggcccgcgccaacgat
cccgacccggacgtgaccatgcgcatgatcgccaccggcctggtgcagttcgccggctct
ggcaccatcgcctccgtccccggctgcgatgaccacgccccgtcggccgacgtggtcgcg
gctgattcggtcgacgccgacaaccaccgggcccggctgctgctcactttggacacgacc
cgcaatttgctgctctgcttctgctgggtgatcaagaacatcgaagcgtccgcgtttcgc
caatggttgagtgagttgccggccgcgcgcatcggtcacttcatcgacgccttgcacgtc
tgcgtcagttgtttcgaatacaagggtcagcagcggcgccgtcagcggcaccagcagcga
caaccagccaagggcggggcggtggcgttggaacagtccttcgacgacggtcaactgtcg
gccgaggtgaatttgatcgtcttggacgcgttcgagtggatctgcaagacggccgtgtcg
tccgaatgtttggtcagcgccggcagtggaccgggcgtcttgggcgcggccttgcggctg
ctgttgcacatgttgtcgtgcaaccagagcgtgctcgtgttgggccagttgttcgccagc
cagcgggccttcgtcgaaaaatatcccgaaattgtgttcgacgaacaagtcgaccagtgc
tcccagctctgcttgcaactgttgcggcactgcgcctcggccgtggccgaagtgcgcgcc
caggcggccgcgtcgctctacctgctgctcaggcgagctttcgagtcggcgttggtcaat
ttcagccgcctgaaaatgcaaatcaccgtctcgctgagttcgctggtcggcggcgcctgg
ttcagcgtggaccggctgcgcggctcgctgggcaccgtgctcgcctgcgtcgaccaggcc
gaccaggccgacaccgccgcggtccagtggagcgcgttcgtcgaccaggccaaagagttg
gtcgaaaatttgaacgccatcctggccgacacggccaaaatggaagaatgccagcaggat
ttcgaaatgctcaccgacctgatctaccgaatcgccaaaggctaccggcgtagtccggac
cttcgtctcgcctggttgcaaaatttgactcagaagcagctggaacgcggccaccacgcc
gaggcggccatgtgctacgtgcacgcggcggcactggtatccgagtggggacgcgcgtcc
ggcgacgcgccccactactggcccaaaggggcggtggcgtttttggccttgtccgagaac
gtgctcgaagagagcgccgcttgggaggtggacgcgttcgccggctcggaccgcgactgg
gagcctcgactgccgggtcgccagttcagcgaggccggcctgtgcggcttgctcgaacaa
gctgctcagcttttctaccaggccagcatgtacgagctgatgcacggcgcgttcaagctc
atcctgccggtcttggaacgacgccgcgactaccgtcgcatcggcctggtgtacggtcgt
ttggccgacgcgctgtcgaggatcgacgaccgcggacccaattcggacaagcgccttttt
ggcacctatttccgggttggattttacggagccaaattcgccgacctggacggcttggag
tacgtgtaccgcgaaccggcgatcaccaagctgtcggaaatatccagccgtctggagtcg
ttctacgcggaccgattcggtgccggctcggtcgaagtgatcaaagactcgaacaacgtc
gacccggctcgtctcgagccgcacaaagcctatctgcaaatcacgtacgtcgaaccctac
tttgaccggtgggagctgcgccggcgtgtgaccgtcttcgaacgcaaccacaacgtcagc
cggttcgtctacgcgacgccgttcacgttggacggtcgcgcccacggcgagctcggcgaa
cagtacaaacgcaagaccgtgctcaccaccagccacagtctgccttacatgaagagccgg
gtgctggtggtgcacaaagaacagagcgtgctgacgccggtcgaagtcgccatcgaagat
atcaacaagaaaactttggaactggaactggccaccggtcagcagccgccggacggcaaa
attttgcaaatggtactgcaaggctgcatcggcaccacggtcaaccggggacccttggaa
attgcgaacgtgttcttgggcgagcaacaaccagtgaacggtgctgctggagccggagcc
ggctcatccaccactgctaccaccgccaatgccggtgaaccagtgagcgaagtgttgcag
aatcgactgcgtttgagtttcaaagatttttcgaaaaaatgcgccgatgcgttgagagag
aacaaacgtctgatcggacccaaccaacgtgaatatcagaaagagctcgagcgcaactat
ttgcactttactgaacaattgacgccgatattgtcgtcggtgccgaacgacagacaagac
aacttgcttataacgaactgcccgcgttggagtttgccattttgcaatacagccgtcgga
tacactactgcacagttggcacttgtttgtcacctgctgttaccaccacttccaagtgga
ctgactggcacttgttttactgacgattattatttgaagaagctgctgttcaacatgtcc
actactggccttttttcagcatctcaaggactttccgatccggctatctgtttgttagct
tctttgatttgcggcatgcacacgatccactcgctcatcagcatttttgtcgcctacatt
ctctgtcgttatttcaaaggaaccatcgattccgtcgtcatagcgtttgtcttcttcatg
tcctatttggttattggatacaatgtgatgtcatctggaaagtacgacttatcttggaca
atgccgcagtgcgttttgactttacgattgattggattgattgttgatctgtacgatggg
atgcaaccaaaggaaaagctttccgcttatcaattagaagctcgtgttgacgattcgcct
gatctgttggaaattgccgccttttcttacttttttggcggatgttttgttggaccacaa
aaattaatcaacaattctgccgacgggtattctgcagatttttgtctattttttgctttt
cagtttccgttgaaccgcttccgtcgcttcgtcgatggtgcttacaacgatgccgaaacc
ggcggtccgccgaagaggtttgacgaattgcagttggttggaaaaatattaaaaatggaa
atttctattttatctattttaagcgtcttcccggcgatgctccgtctgttcgccggcttg
gtctacggtgaattattcatttttgtggaaattggtctacatcctgttctggttccgatt
tgtggtacttcgttatcagtcggcatggctgattgcgcttgtggcaatgctgaatcagca
tcagcagctgaaggccaaactgcaaagttcggcagtgatctacttgccgctgtggtgcgt
cagaaagttcgtggtgctgctctcctgcgcgtacggcttcttgccgttcgctttgcttac
tatcgacaagtggtggaaaactgtattttgctttttgctttttcactctcacaggtctac
aagagcgtctactttttcggctgggtaatgtacggtattgtttggccgctgattgtggtc
tcctactggtccactcacggctggagacggtcgaaagccggcaacggaaccatcccttcc
aaggaaaatgcccaagtgaacaagtcgaacggggctgacggccgcaacgtgcaccagaac
gtcgacaacgcaatcaacaaggctaaaatcaactaa

DBGET integrated database retrieval system