KEGG   Trichinella spiralis: Tsp_05689Help
Entry
Tsp_05689         CDS       T01609                                 

Definition
(RefSeq) putative immunoglobulin I-set domain protein
  KO
K12567  titin [EC:2.7.11.1]
Organism
tsp  Trichinella spiralis
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tsp01001]
    Tsp_05689
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tsp04131]
    Tsp_05689
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tsp04812]
    Tsp_05689
   04147 Exosome [BR:tsp04147]
    Tsp_05689
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Tsp_05689
Protein kinases [BR:tsp01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   Tsp_05689
Membrane trafficking [BR:tsp04131]
 Others
  Actin-binding proteins
   Others
    Tsp_05689
Cytoskeleton proteins [BR:tsp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     Tsp_05689
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tsp_05689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig V-set Pkinase fn3 C1-set C2-set_2 Ig_6 Pkinase_Tyr Receptor_2B4 Titin_Ig-rpts Ig_4 Ig_C17orf99 Kinase-like Kdo Pur_ac_phosph_N DUF1699 APH
Motif
Other DBs
NCBI-GeneID: 10913511
NCBI-ProteinID: XP_003372045
Position
Unknown
AA seq 12419 aa AA seqDB search
METNGRDRERETWQPLQNKRSVVGQQVILECQLEGQPDPVIKWLKDGQNVTNCPDYQIFQ
EGNKFKLIIPSVQMADAGRFDCQAINAAGSKSSSCILIVAPPPSPGERQFMTAPSPRPPP
TPVGPAAPYVVKELKHQMLKIGSSARFECRITAFPAAEITWLKNGKPITNTSKYKIDNDP
DSGICSLTIAMMFAEDVGQYSCSARNAHGQAVTSAEILYKDKYNEWLREEQIKITQEKKR
SMMEELDNAVQQPRKQKGTFYTPHSQRLLEQLYTEEKVETDIKINESETSVENVPFQGVP
QPPQVIRPLQPVSIIEGQKAELTCQIKGNPTPKVRWMKNGVPVQNSQRLQTSYNGAVASL
IIKITFAEDAGMYTLVAENQFGRTNQSANIQILTQNNVNGVVHRGNNQNDLNTLIIYMAT
VEDSGTYTCVATNESGQAQCSCELTVKAHSQGSAAHFTEKFNSLIVHPGDSVELKCSAVG
QPRPTYHWYKDDEELIPGQCPYDIVNMPNGTRLRINNVRLDDSGCFQCNAVNMYGTAIHK
APVKVQMKSSSQQITPFPRGSTSDQALIASATPELATIRHRQRAAGLSNAAWFVEAASAE
PPKIIGLSADHLSLLEGQLAHVEVRFQPENDQNLKVVWFKDDLPLEQTGRASFDIDYVQL
SDGGLYKCLVVNQKGKAEATFTISVTELPEVDFNESHNYRENVSSKVRPNFVHELKNVEI
VEGRSVRFEAKLVPTRDPSLQVDWFFNGQPLRLGNRVKMLQEFGLVSLCISAVSVADAGV
YTCRAKNLIGVSESSATLIVKTYEIGNYKNADNTRGYIADVDIADVEEDSCKMPCFEVNL
RGGTVKEGGRILLDGKVSPARDPYMRIDWFKDGKPLKLANRIKMQYDFGFVSLCINPTYH
EDSGVYVCKASNRVGVAESSAEICCAGDDSIELRTQHADSLQRIQRIEGQEVHIGPYIED
RPEEVMSIEKPRFTKHLSNAEISEGQTAHFDGRLLPFNDPKMSVNWFRNGLPLPNGHRFR
LVNDFGYVCLDVLYAYPEDSGIYTVVAQNELGEAASEAQLHVIGHKSIYLESQHPDGMNR
IQKLERQTEIPLHEGIERISEHSPVLKNQLRDLTLREGSNLHLEVRVEPVNDPTMHVEWF
VNGRPLLTGSRSQMTFDFGYVALDLKSLIAEDSGEYIVLIRNQHGEVTSRCIVAVEAKDS
VLTEVQNVESFERIKALETEKPRQIQESESLPQSAPVFTKVLSPASITLPEGSSLHLEGE
IRPISDSSMKISWLRNGQPIPIGKQAVIYGTQHPNSYEQILRIEAPKQNREEIDEEQPDA
PYFVKELPNEIAITEGQSVHLECIAEPKNDTNRSVVWYFNGQPLKMGHRFQFSHDFGHLV
LNVLYAYPEDSGDYMCIIRNQNGEARSVCKLQCQGKKSMVLETYHPDALRQIEELERPTP
VQEQLDKHCTEKPEFLNTFPEQTEPLLEGQAFHVKSFIRPTDDPNLTVEWFHNDKPLLAS
HRFQTKHDINFVSLDILQVYPEDSGLYTCRAKNKNGTAENSVFIACNSRKSVITEASQPE
SWERIRQMEAVLPQTAEEMPVEKVKPSFTVPLGGETDVKEGQSVHLACQVSPTDDADLKI
DWLFNDQPLKMGSRFHTCNDFGFVSLEIDPVFPEDSGVYTCRALNEKGEAFTSLKIGCKP
IKSVDFDSHHIQSLQKIKELEEAQPDRPPSPEIQYHPPTFTQVLQNVDTINEGESVRLEC
RLQPAFDPSLKVTWLRNGQSLPLGSRFRPTHDFDYVALEILTVYPEDSGIYQCKAQSAHG
EAVTSCSLKCIQIERPAIVESIAETPFITPPSFVEPISGMQTVNEGAPVHFECRVQPSND
PNLSVQWFRNDQPLMNGHRFRTGHDFGFVTMDILYSFPEDTGQWTCRVANSLGAEDCHAN
LVVVPKQSIYSAACQPKSLAKIQEIEAVPQKQDAEQELVPVAPSLLQPFENTERFEGQPV
HFECRALPVNDPKMIIEWLHNGLPIKEGNRFRKTFDFGYVSLDIAYVFPDDSGVYACRAR
NDLGEAVVQAELTVLSKGSVMMDTTRPESWHKIQELETVAPALAEAEPAAAVQPRFTQEL
NSCTDMIEGQPAHFEGKIEPRNDSSLKVQWFHDGKPLPASSRVSFQNDFGLVTLDIAYCF
PEDKGIYECHVSNAAGTTKSTCELQCKARSAILADTMHEGSLEKIRIIEAPKDVPPSQDV
ACNERPVFTQPLRNIDDVPEGEAAVFECRLRPINDPNLHVEWYFNDEPLKISNRIMPTQD
FGYITLKLASTSTFDTGVYLCRAWNLLGEAVTTASLQVQVNNLHCHARQRAVGSLFHGIF
LGKENILRDSQHPESYRKVQIIENLEKFPRQEIAEIAYEKPAFEQVMENLENLNEGTLAR
LTCRVRPADDPNLKTEWFFNGKPLAHSSRIHLMHEFGYIALEIDPIHVEDSGVYTCKAFN
GSGEAVTSASVKVLGSESLLLQTEHPVSWKKIQNLEAKPLVEVEEQETIQEKPRIVQPLQ
NYSDVPEGSAVHLEALYEPAKDNTLVADWLRNGDLIIASQLVKTKCELGHATLDIGNAYA
EQHSGVYTLRLRNREGEVMTSCSVKVLGKSNVLNDTQHESSWRQIQELEKPKEAEGTPAG
ISYGSPVFTEHLNNVEVNEGESASFRCQYEPVNDPNLKLEWLLNGKPLEASSKFSVNSEF
GYVLMNIAYVFPEDSGVYTCKAINAAGEVSTSGTLKCFEKANLILESQRSGAMAKIVELE
APKSLPTEDDTVPMLAPQFLTPLSDITGIFEGQAAHFETRVEPANDPNLVITWYHNDIPV
EATSRMKQINDFGFVLFDISSVDMRDNGQWTCVAKNKVGQAQCSANIQCSPKAGIIRDSQ
QPQSLPRILELEAVKATPEVLPAVPPEAPKFITCFPKLDPLTEGDTVHLEAQLVPVEDAT
MKVEWFHDNKPLLLGHRLKTIYDFGFCVLDIICITAEDSGEYKCVATNASGSDCISTTVT
CQAKGSLLLDPISQTKAQAVKDLEDSLQRIPEKDVPEVLSMAPVFTHPLQNQSQLVDGDS
VHLEAQLIPVNDPDMKVEWFLNGNPLKHGSRVKCLNDFGFVILEIAPVYAEDSGEYHCKA
TNSQGEAVTSATLVCQPRERIIREMQLPKELASAQKKIEELEAPKQKLDTTEEPSYPAPT
ITPLTETELEVNEGQVAHYEFKLEPLDDPKMTVEWLYNGKPLSHGSRLKALYDFGFVVLE
LAPAEPHDSGEYTCRAVNAAGEASAKVSLNVKMNRGVSYDWMLSQADARNKITQLEDYLH
RPPEEASLLEQDFGQPVFVQELSDLGDINEGEAVQIDCRIQPVGDPTMRIEWWHNGHLIP
YSSRIQTHHNFGYVALLIQHAIPEDTGEYICKAINSKGESSSKCILTCRSSTSFPPPKFV
SPLLAIISDVNEGDSVHMECRVIPINDPQLEIQWLFNGKPLSTAHRFKTLSDFGFVSLEI
LYANPEDTGTYTCRAWNKAGEDSTACTVSVKKRPSLIFERQAPPISSLDIARRISQYTTK
PCVLSAENFYQDRKCQKPQFVSQLENTAVNEGDFAKLECQLTPINDPNIRIEWYKNNAPV
ILGQRFMSITDFGYVALVLLYALPVDTGEYTCVATNKFGSDKSVATIACAPQKRVITDSQ
MPQGKSVASISRNDEMLHWADSTDAQNRVNQAPAFTIAPTHIQAVEGQPARFSCAVTGMP
QPKVSWFVNDKQAVNGSYYKLGYDGMHYLTILKVRPQHAGEVHCVAKNSEGEVRTTTTLD
VFRVEDFRSHSLKPAKREDDMDIARREEQWKQESLGKLKDAFEKAPKADLQKLMRIETDK
QQPSPLESKELIDKFKKKKQDDFYDKIYLTEQSKVVPPSQFTETVTLRATPMLEKELPKE
QKIEYKLRPAPRTKATSDMQTQPAWHRSSRRHLTDEEENALYHRLPEQQKEPEIFARDLV
TLKSVKPNIAMETADESHMQLEEHKLASTPSNKSQQTWTTNQDIPSQQVTLKPSFVPRAV
ASQESGTFDVESRKDAAAAMLKTLETENTSKLVISKAKHNHAGEYTVVIKNVAGEVKSTA
DVVVGEKISKGFSPKFIQEIAEASVIQGATIRFDARLAGKPIPQVVWLKDDKQIIDDAHF
VITADQDLYSLIITEAFPQDAGMYECVARNVHGEAKCHATLTVTKPTAFKPSPQVAKNVQ
SASLPQLVVNKGDVATLKIPVSAEQVKWYKDNKLLSPDNRISTMCKDGIVSLIIKNSDIH
DSGNYKAEITSSKGTSVAVFTMLCKDSHTFYRWASHSFPRKTPKSMPLGFTSPHSSDRIS
AAESISYDDIGSALYFETELKDITSEAGTPVTFACKLVGDAERIVWRKDGQIMEEGDEFV
QQYNSHNGWCKLTISEVFPEDQGIISCQAINKSNESVTSCFFTVQDFKSNTKSKSASAFP
SLEMLPPCITKHLETVTTPPNTTVCLFVEFYSTAAADVQWFYEQKALPNSPKCTQRRGTN
WAQLQLISPQEGCYSVKVTNDFGTATSIAYITVQEQWKSLEHSTESINISEMIDVEAYSS
ETYEKGIASMHSPYFLKKLPDKLAILNRKLHLTATVDAIPEANFAWYFENVELKCSTSCY
ITSWKNQSTIVLENAKHGNYKVVASNALGSCESTVTVYEDYLISYVFMLDESESNRMSKF
APQFIKKLHNMSVEAGEELKLVVEVLSEPVASFKWFMDNNNVSPSTVMSADNTSELRLIP
EEGKTHTFVVKAENEVGVAVNSGVVIVKPCRISKRISDDISWHSNDVYFEETEMMHLEMS
GNFPYQATHKEYLDGEVDLYPLASTKSAEKVISDQTQPSHTDLAPKIILPLENKTASSTE
NITLSCKIYSAVAYAILWYHENHRLIDSEETQIVVKDDGSQLIILKRPSETDAGLYTCLA
VNNYGTASTSSRLTIMKPALPFTYQQEMRDLYSTSMEAIEICQETDVVQQKKVTIESTMP
QLQSSGALRAVSQTEFTANANLSANDFEVSTVIQHFSKEYASADISQSVMKETNEEMEYR
AEITKPPYDDTLNLYSISAASTKPSFTDVPVFGMERTIHMEIFEEIKITESRQKATHQTE
TVNIEFEFCTSPSEEVYINLDAECFSCGSRIHLKGSMPECKEITFEQRNIEEMTILYEET
TSIRYYSSTVTSHEEELSSASDLYIDKLTGPLSLYSEESIDGNFSFKLIVVSECAHTVPL
CRELSFMVAVSYAEHEWNTVVRIIQEETHQYEEECLTSYFTAATKPALMPQADYVSPVIA
TKAIQLEVTDAKEIHEKILSDHSITLHMDVCLEAMNNASAYTLLTTSDRFVCTATIHTEG
EQKAEEITKTVSEITHEEVLCVIETQIRSEISESEQTIYLEILCPSSVHYCNLLVKCGEI
LQTMANVYLESKTVTLLIDNISKVREEYNEQYSAPELVLERLPQQQLIQRAASSTEAAVH
KSMNACHMTEKFTTIVLVNKNSEEIEEVLKISTKPLEEVHVHEMVNSFQLAVDKEEHLQE
TCSFQVPRRILQTVEIIEDECLEEITVHQQRTVSTMLDMLVQLEIPSQQFLCDIEVQLSL
TASCEANLLKGKEETVKTEQSIKWVVEECTQESFVEIVLEEAKHIELRVTEQHLDIQINC
HDINNSVAALLMFFEWCEATFNVQEVLPLSKVYEQQKTLTTSSTSVESILISKQTKYEYV
ETTITGDVLLHRPSDYFELIVCIDGVNVEAIFCKASLVENAINFQQVALQRRECFDVSLP
VKTFTEQCVRVTKIQEIEKVVCEFEHIVFDSFQTTVDYSMEANLLVDISKPSCAFHSSII
VMLCDSSHATMSIINRQEESTSSITTPYNESMFEANLRLIISTDDSISSTTSEMEQGIVS
SMEVSSIAEEAVVLSDSSVHKMEATHVVSDEGKTLAIDIHNPVSAAFSTACIEDISIFSV
EETNVVCQDWQCSYKFACPSKVSKTLVIVESDMCDSAKFTTTDKTVEFSYMELIDICDLA
ITILNGMEYSSPTMVLRISATDKTALFHHLTQSSEIKVLIDVEANNSTRLLTAFEFDTIA
SELENRSFWSAMCIIENYENAESFLAVEMARIKKQSIHEVSEEISVVIEQLHYEEKACEI
TFESKRLSSASFNFKWKDDLLYDVTLKNHLTLSEAIACVISCMDIEAAKIYFYEVISTKM
LLNNSTAENSVITLQYCHPLTQLLKTHLTHADISSLKEVLPILKTEITASEMIKEDVESN
LLCATTAVTELINATIDYELIKEVSASVHTRAADAEVSKDTPTVTLKETYSENQQDSDVT
VELLCSSKSCSAEAIIFPYVWESCVKQQDLHSINFTAVANLKSESLRTECLISPFLNETT
SVSVRIQTGRLNQSSVTVNLAKENMKDHVHAVVTSLDFQQLKPFKACCPQKHLTSVDFCA
SKKFEIYNTLATTIIPETCLLDYNTTLIITKKNETVTEETMTETTVNSFELPDLRNAAET
QFTSLEHTAIDTFLEKMPFYGECGAKIECSDTQSGVMQHGSHVCVVEREFECKDAPMLTA
CLIEAATDKCYTQYLHDSFKKSFYDFLLTHVESKEECEVVLKMDTCLEEEGTLYDNVVEN
VCVDSFFQTVAKPHSTTELRDLHAISSCISRFKSEESPVVTHQWIQAFSTEAKCTIEESV
SDIISANVTLRTKDFEYAECSIECEFRSAVEMEQTYGCIENAENACLSMVYDIKKMLPAS
HYVSHDISITPELQLQEVSVQEITEQAEFTHKELLDASEVIQIVPSGTILRYVVDCAYEE
NSISFQASNIISDCEMAKCLEANQQSVITFVFSCDISNITTHYRTSSVTDTIEAAIPEYS
HETWEFASADVCSFEKYISVSPCSSAFAEYARAGQAYINILSVLECASITENIAMENLSK
CDGCQHVISHLLKETYGSCHNVLSKAFINTSSASDESQLIINFLKQTADAKDFKIQYEEC
SVRTDYLGESSTVIECTVQEVQQESVFKLLKLSSMLNEKHFDSSLESDQHFRSCQCTVHS
LVMETASLAITLEETCADFGVSPPVADELITKSHSTHPFSISEKQEKFTVVATDINLDSS
LSSSSVEYTTTALQRMSDATLHEIINVSNDFLCKRENIFDEDEILHKYVLQETIFQSAEK
TDLSVSMEKTEESEQCTFTRWSSVVACTVPIYYSVSKMAEEIPIPALPSMKETTVEVLLE
KPLSVLECHFNFTDFPSVISYLGLNRQLITCFNVKPEAFEKISTSWADVDVLAQDMSLTD
NSKEETYSIENKQRSESEIHYSTDEEKCLQASYEEVYNNVILERTSVEALEIPMKSEEII
KCSSEHVYCEITFVLKEDNKSAQSYMSSCNFESESAFISLIEKDLTCTVKACNLAENQNI
LSSELLEKFENHVTTNYIDEVAQFQHDDELQDAVTLNAKDNVIAGLQLTTTQKFENVMLE
VSWLHQLEFGDLQSIIEQPDRIVTDIHIQPISPKQTQEVLEVIQTTDEEKFQSISCSSNF
TQENEFKNDIICSEANKEHAMLYLHLVDTPARQDVFGQAPEFTLHLCNTEIAEGSHVRLK
CIVSGQPTPDIQWFVDGDQLASSEDFNIIYEDGVSVLNIKEVFPEDEGEYSCEAVNQFGT
ARTAAYLAVIPVEKQASATDKECTECYGKEFANDEWPVETVTMSQECWSMLKSEASCEAD
VAVRITDLEQLKCLSPISDGIAEIVASHLAETNEVFVYGSTKSMEDTSFTHISEKAVESV
AEHTLNMRENFAEVNTLVSLSLDANQNISLQVVLKQPRVASLVFCLTSLTKPILPTLVND
QETARKYGLTLHSISDDSIALNVGNSESFADSSDFKSSSQDAFVSIDVDLVHMGARCCGI
FTLLSRPTESSSLTLTECELKELKVLQSLLMLPLSREDCFPLIERYIRECKGYISMEATL
VRRDSELSISACEIHLYRQFQNVRLSLVTVHKHLEQTDNKADLSKEFPCNEVACNFLDTH
YSHATCEMKLFNLNSEAFIDFNSVSANAEFKDTESMLVSLDFEQIQSQPHVLAFCIDNQM
LSLSKNFVSRKGCYSDVEIQNIGGDLETFTNIPHSSADYSCLDEISCSILIEKASESISC
SNTYASADMLNISKCSLFIPFLKVDDSVVGVDVQISKDWKRIGNDIVSLPETETNQLPCE
VAVAMIISEKIAKHVGSTAAFLSEPSFFHEMRTASLFPATVSTTFISENVNNCETEKIFY
SPSITRPPTFTVLSNTISAKYEDIEVLKLDEQHGIQTELYDMDLSTSRTNMCLCQRNALI
RKCNAENNRDVITGHCSATLPVKHTENYDIALTVLSFNANALSCCEVHENITVQKSESSN
SLSVSPDSIASKFTAVSDYSNVEQCLTVQNNLENDIFFHSEFSQIEGELVVASNPHDSYT
CILTVAPFYNCEMWRSVLVCSCCYDALVETDEEANITFSYNKTTIECCTSISFANSYVEI
YCPEDVADISVKLGCTAQQPYQQSLNESQCSLTVLIEKDESESREFIDFPEKVHSVTNRS
FFARQTFLEETVDVQFRSSANNCFADHTYHEGGDKSKCAVIKVENKADEDFQLFAQGIKQ
DSKAETVEHIKQYFVPHGSDTKLMEKLSSSENLVQWFINGSPLVITSRHIVHTENGCCEL
FISNVTFEDSAIYSIETDAGYIRPVAELIVEGNAQFFVLAPFQRMYTFHFNNPFEIVKHF
YISSDSTSPDLDNAVIITEKPFQCVQQNLDAELHGPEQNANTDINISEDQHFYASKTYEI
DILENIMNLTATSTSEIVNDIAKAEKITDVKRQEIVAHTDLTADMALNLMRAEEIELSIA
ESSNPENACLEVLNLFVARQRSDETMLATNTLNLKTPEQSAALCCSEEENITSLSTINMN
FLFTLGPLSCSKTAFNSEMKKMLHCANIILSNAHMFASYDATENLTTECCIDESDTCDTQ
FSSVDCGKMLLTSTLDQKDDVSYTACVHQRLKEETSSTQSNFVDCNLIHEKSADHKEAVA
SFSEQCSDTISSSVTTATITKKIVSIDDIPIIAVGSEIMESLRKPKRKEKRKISEITANE
SFNWNNDLKVERICMEISVENCSSSIKAESVQALIEADHKEETESICCLHQPHFFVESAF
LLSQKQQSQEKQTLNILFSAKFAVSESKILLQELCTASEEAYISIKEHYDVHLTCKQTEE
AVSSTLSRTVTADEVDFENKKEVIEESAIIEEPTKSSCTAFDVHESLHDSGDASFHFTLK
YHQSAHIRRASDFSELTYTINLPNLERKQYEEMQFQDVNYLKSPEQLFKETITTEEQVEN
AILEHSVDDVALKVESQSIPAKEGASAEIEIKDFYKGTTVMNIITTVMKKPISEEVTKIL
EINQMAENAYSCGQLAESVTNETRVKITCKKPQEIMAVQALFAEVTTLFSYEFHVGQRIC
KPLQETSRLLSAVDTTQRYFQEISAEVECRATDDNTLSTERGIDLSVHSMSSSAVSKTFA
DIKVVLEQSPALEITFNLEKIRETLLFNVCDQYFKLELPLKQLDAFMSILLPYAVNITHH
SAECILGSAINFVETDVRKKSECSHCVKECSCAPFSGCAICISRANVSMSVILDKPSTSQ
SEAMIPIEQKLGLEYLDFTYASEFTAPIQSEEEAHLISTAKTSQQLQHIKSTENVVNVDA
NINGFEANAEVSTIALRKEFFKVYHSVRADEMEFTSEGFFSLKNKDQVVTEEASTLNTLE
IYENFKREDDHSDVTFQKLIIYEIPPLDETLSFSVVAEECCLKQADHSECCQAVIAENKV
CLSHFQFKHVKDHIHSCSCDIYFSKESEVAPCTVQLGKLLLQCTMSESSCFLYIPNGSSL
AAETELLDAQAVKIPALEILHTECACEKVSSWKGNIELPVKEKICVSDFLLKDYINSDFD
ITVRIDSSHASYAIKNICIVASDLEKITVSSICTCFEKGSIEEMTEEIFAESLLGIRKYR
HRHLKDFTEAACYCIALTKHQESLSCISSYFTSVRESCFADIKHLKLVENYIKPTTEEAT
EYDYVSVSTAEKVDVSTIMASSTFLEKEISALCDITFEKKADISSSNEFVMHTKSTTNAV
FSVEGNAFYHVSAELSLSHKSEKDEIYEQEDASYCTCSIDASLEKLPSKDYAYAFVDLSN
YGKRVFTFKHFRDIIEASSVSSSLQRHPPEKPELFVENLFATSSDIIYTSEKVNFQLLLE
AKTSITTIFTRQLLNDVCSITLPQMNQFEELVTSVKIAPVIPTAHLTVTRLSDHSVNLEW
NHPSETTEDNIDGYDVLLKGETDDEWSVVAILDRSQTHCILEDLTNSYTYKFAIRIRKED
AQSELLETESEVYVQSRAVSLPKRPKGPLKVNVKTMSSIYVEWNPADAEDFMNISSYVVL
IRESQRTTWLEVATVGPEETRCHVSDLNSGSEYHVRVIAVNSLGISEPLETEHPILMERI
PTLLTPPSPCKPPLNVLSVHNTSVTLQWNPPEDDGGSPITGYVISRRHLAQKHWEEVERL
PEFVLEYTVSNLKQNARYLFRVNAVNSIGISEGTQTTEPVNIRKWKDKPGAPGKPTVKEL
NADFIVLQWSPPEAANNATVTNYIVERRDEGCVRKNWLVVSRGMNPNAELLVERLIPGNT
YTFRVSAENDSGIGPASEISDNITLPLKTVGIAPNFLTLLEDTSVFENEDITFNVQFCGQ
PAPHIKWYKNGREICSDEKHRISTAKNHSSFQLLNASENDEGEIAIEAENCHGTVTQSAQ
LKLKAVAKIIRNEITQNELLRGIGETAHVSFEVKGSPLPTVTWEKDHQQLTVSNRVSVQS
DGPSQSLEISQCTYEDSGIYTLRAANIYGEDSIDVKIKITGAPSSPGKPVVLECDEESIT
ISWTPPLYNGEAEITLYYVESLGVGNDWTVFGTTKQEKLTASFTVEETPVKFRVKAENVH
GISEPSEATIWTRMLEQTEDITVNLTFQQYKEKQQRQMSEFDSLVLPVPPTSLHKTDGQL
PGNFYDKYTLCEELGRGAYGVVYRAIENATGLTFAAKIIQTRPGIPKDNVLHEIDIMSQL
NHPSLLTLHEAFDMNSEMILVLEFVSGGELFDQLLEGKENLPEKEVREYIRQILHGIEHM
HQKQIVHLDLKPENILLSTSFSKDIKIIDFGLASKLKKNKSVQLLFGTPEFCAPEVVNHQ
SASFCTDMWSVGVIAYCMLSGISPFAGDTDEETLANVSVADWNFDDSIWTQVSDTAKDFV
SKLMTKNKKTIFSLAFTYFAFMQFENHRQMHYQIERSKIYFSNRMTVEEALQHPWITEEP
AEVTEIAAPEERPVPQLKLKKDSITKRRWSDELLPIGKLAKHSAILRQASMDGVFERELH
LEVPDKIPNIIAKLENTVAEAGDLVVKLKCTVDGSPRPNISWFKNGIEITTSKKYKIFHD
NTNAELNISNISEDDEAVYSCKAENKFGYAETAARLTVKKVDKEDSLKRSDSVPTFFSCP
YDQNVMVGESFDLLVHVGGKPFPQLKWYKNGKQINDTSEKYRIQRFDDKECITIQSFQKD
DAGLWQCIAINDLGTCEVKFRLTLKYPEEFCPPKIIENLKDISVENGQSFQLQLLIEANP
LPEIKWYKNNTEIHHGEHYKMYFDDKNSTYALSVNPAYVEDSGIFKCVITNIIGSDETSC
KVTVEGEVENAHYPEFLQILTDVTVEENSQIALECLVEGIPFPKITWYKNDREIEMTNRM
MYTEDISGHCALRILNANEKDAGIYLCRAKNIAGETTTQCVVTVVDVKCKRSINIPDESE
LESEKQIVEPLHIVQPLQDVFATAGKSILMECEISSSPRASVQWFKNGQFITENANMRLV
FDGRKATLRIIEASIDEHQGEYICRATALDSVVETRDEGEEQHSDLRFTSIPEQAAPIVY
SEVEDIQNVLKRPVADDVELTWSDKETLIDSFYITEVEKTSLTLCWSEKGQHHEAALYKI
FVRPQHASKWTEVGITKNSAFHVINLQEDTEYEFLVTAKRQKEWEKPVQLSVPADKSKIR
TLPKLHCLSDLNVKLNVGEKLKIVCQVDGNVTSVITCYKGNTKIQDDDRIIVQHQNDGTI
LLMIESVQENDCGSYTIYAENEYGFSYQTVTVTVTSANVISEQRETPNIPCILHPLVNQT
LRTGKTATLTCRVRCIPPGKIRWYKNGQKLKSGNRYQLLASKHQAYRLMIHNVDEEDTGL
YQMAVENEYGRASTECMLTVKGGVQHKAPFVEKSLEDVRTNVGSKVVLKCKITGQPNPSI
IWLKDGQKLKSSRDIQLNFDDNNCMLIIHSAAVENTGLYACSATNLVGTVNTECRLLVEV
PPDNILSKYKAPVFTLTPELRLAALENENIHLQFETYSDLPVRFTCLKNKLPADAGRLNT
QIYEGTHMSWTINNAMISDSGEYTCIAENDVGSSEFTFKIWITNLSQCSDEEMQELKEK
NT seq 37260 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaatggacgggatagagaaagggagacatggcaaccattgcaaaataagcgg
tccgttgttggtcagcaagtgattctggaatgccagctagaaggtcaaccggatcctgta
atcaagtggctaaaagatgggcaaaatgtgacaaactgcccggattatcagatttttcaa
gagggaaacaaatttaagttgataatacccagcgttcaaatggcagatgctggtcggttt
gattgtcaggctataaacgccgctggaagcaagtctagttcgtgcatcttgattgtcgct
cctccaccgtcaccaggagaaagacagttcatgactgcaccgtctccacgcccgcctcca
actcctgttggaccggcagctccgtatgtggtcaaagaactgaaacaccagatgctgaaa
attggttctagtgcacgatttgaatgtcgcatcactgcatttcccgcagctgaaataacg
tggcttaagaatggaaagccaataacaaatacatccaagtataaaattgataatgatccg
gacagtggaatttgttctttgactattgcgatgatgtttgccgaagatgttggtcagtac
agctgctcggcaagaaatgcccacgggcaggccgtcacatctgccgaaattctttacaaa
gataagtacaatgaatggcttcgagaagagcagataaaaattacccaagagaaaaaacga
tccatgatggaagaattggacaatgccgttcaacagccacgaaagcagaaaggtacattt
tacactccgcattctcagcgtctgctcgaacaactgtacactgaagaaaaagttgaaacc
gacatcaaaataaatgaatcagaaacatcggttgaaaatgttccatttcaaggggttcca
caaccaccgcaagtaattcgaccattgcagccagttagcataattgaaggtcaaaaagca
gaactgacatgccaaatcaagggcaatccaacacccaaagttcgatggatgaaaaatggc
gtacctgtgcaaaattcccaacgtttgcaaacatcatacaacggtgccgttgcttctttg
ataatcaaaattacctttgctgaagatgctggtatgtacaccctggtagcggaaaatcag
tttggcagaacaaaccaatctgctaacattcaaattcttacgcagaacaatgtgaatggc
gttgttcacaggggaaataatcaaaatgatttgaatactttgattatttacatggcaact
gtggaagacagtggaacgtacacttgcgtggcgacaaacgaaagtggacaagcgcaatgc
agttgcgagttgactgtgaaagcacattcccagggttcggctgctcattttactgaaaaa
ttcaactcactgatagttcatccaggcgacagtgttgaattgaaatgttcagcagtgggt
caaccaagacccacatatcattggtataaagacgacgaagagctaattcctggtcagtgt
ccttatgatattgtgaatatgccaaacggcactcggcttcgaataaacaacgttcgactg
gacgactcgggttgcttccagtgcaatgctgtaaatatgtatggcacagctattcacaaa
gcaccggtgaaggtacaaatgaaaagttccagtcagcaaatcacaccttttcctcgtggt
tcaacttctgatcaagcattaattgcatctgcaacacccgaattagcaactattcgacat
cgccagcgagctgcgggcctctctaatgcagcgtggtttgtcgaggctgccagtgctgaa
ccgccgaaaataattggcttatcagcggatcatctttctcttctggaaggccagctcgct
cacgtagaagtacgctttcaaccggaaaatgatcaaaacttgaaagtagtctggtttaaa
gatgatcttccactggagcaaactggcagagcaagttttgatattgattatgttcaactt
tctgacggtggattgtacaaatgccttgttgtgaatcagaaaggaaaggcggaggcaaca
ttcacgatttccgttacagaattgccggaagtcgacttcaatgaatcccataattaccgt
gagaacgtttcgagtaaagtgaggccaaattttgttcacgaactgaaaaatgtggaaatt
gtcgaaggtcgttcagttcgtttcgaagccaagttggttcctactagagatccaagtctc
caagtagattggtttttcaacggacagccacttcgtctaggaaaccgagtgaaaatgttg
caagagttcggattggtttcattgtgcatctcagcagttagtgttgcagatgcaggcgtt
tacacttgcagagcaaagaatctcatcggcgtttctgaatcaagtgccacacttattgtt
aagacttatgaaattgggaattataaaaatgcggataacacacgaggatacattgctgat
gtggatatagctgatgtggaggaagattcgtgtaaaatgccctgcttcgaagtcaacttg
cgcggcggtactgtcaaagaaggaggtcgcattttgctggatggtaaagtgtcgcctgca
cgtgatccttacatgcgaattgactggtttaaagatggcaaaccgctcaaattagcaaat
cgcataaagatgcaatatgattttggattcgtttccctttgcataaatcctacctatcat
gaagacagtggtgtgtatgtttgcaaagcatcgaatagagtcggtgtagctgaatcctct
gctgaaatatgctgcgctggcgatgacagtattgagttgcgcacccagcatgccgattcc
cttcagagaattcagcgcatagaaggtcaagaagtacatattggcccatatattgaagat
cgccctgaagaagtaatgagcatagagaaaccccgcttcacgaaacatctgagtaatgcc
gaaatcagcgaaggtcaaacagcgcattttgatggtcgattattgcctttcaacgatcct
aagatgtctgtaaattggttccgaaatggacttcctctacccaatggccatcggttccgt
ttggtaaatgactttggatacgtatgccttgatgttctgtacgcctatccagaagattct
ggtatttatacggtagttgctcaaaatgaactaggcgaggctgcgtctgaagcacagtta
catgtgattggccataaaagtatatatttggaatctcagcatccggatggaatgaaccgt
attcaaaagttagaacgacagactgaaattccactacatgaaggcattgagcgaatttct
gagcactctccagtactgaaaaatcagttgcgtgatttaactctccgagaaggttctaat
ttacatctggaggtgcgtgtggaacctgtgaacgatcccactatgcacgtcgaatggttt
gtcaatggtcgaccattgcttactgggagccgttcgcaaatgacgtttgattttggttac
gtagcactagacttgaaaagcttaatagcagaagatagtggtgaatacattgttttaata
cgcaatcagcatggagaagtcacctcacgttgtatcgtagctgtggaagcaaaagattca
gtgctgacagaagttcaaaatgttgaaagtttcgaacgaatcaaagcgttagaaacagaa
aagcctcgacaaattcaagaatcagaaagtttaccacaatcagctcctgtatttactaaa
gtcttatctcctgcttcgattaccttaccagagggaagttctttacatctcgaaggagaa
attcgaccgataagtgattcgtcaatgaaaatttcttggctacgtaacggacaaccaatt
ccaattggtaaacaagcggttatatatggaacacagcatcctaatagttatgaacaaata
ttgcgtatagaagctcctaagcaaaatcgcgaagaaattgacgaagagcagcctgatgct
ccgtattttgttaaagaattgccgaatgaaattgccatcacggagggtcagtctgtgcat
ttagaatgcatagcagagccaaaaaatgacacaaaccgtagcgttgtttggtatttcaac
gggcaaccgttgaagatgggccatagatttcagttttcacatgattttggacatctggtg
ttgaatgtactctatgcgtatccggaagattcaggagattatatgtgcatcattcggaac
caaaatggagaagcacgatcagtttgcaaacttcagtgtcaaggtaagaaaagcatggtt
ttagaaacctatcacccggatgcacttcgtcaaatcgaagaacttgaacgtccaactcca
gttcaagaacaacttgataaacactgcacagaaaagcccgaatttttaaacacttttcct
gaacaaactgaaccacttttggaaggccaagcattccacgttaaaagcttcattcgtcca
actgatgatccaaatttaactgttgagtggttccacaatgacaagcctcttttggcaagt
caccgttttcaaacaaagcacgacatcaactttgtttcattggacattctgcaagtgtat
cccgaagattctggtctgtacacgtgtcgtgcaaaaaataagaatggtactgcggaaaac
agcgttttcattgcatgcaacagccggaaatcagtgatcactgaagctagtcaacctgaa
agctgggagaggattcgccagatggaagctgtattaccccaaactgcggaagaaatgcct
gttgagaaggtgaaaccatcttttacggtgccacttggcggagaaactgacgttaaagaa
gggcagtcggtccatctcgcatgtcaagtatcacctacggatgatgctgatttaaaaatt
gactggctgttcaatgatcagcctttaaaaatgggatcgcgatttcatacatgcaatgat
tttggatttgtttccttggaaattgatcctgtttttccagaagacagcggtgtctacaca
tgcagagctctgaacgagaaaggagaagcatttactagtctcaagattggatgcaagccg
atcaaatcagtcgattttgattcgcatcacatacaaagcttgcaaaaaatcaaagaatta
gaagaagcgcaacctgatcgtccaccctctccagaaatccagtatcacccaccaacattt
acacaagtgctacagaatgtcgatacgattaatgaaggtgaatctgtgcgcttggagtgc
cgactgcagcctgctttcgacccttctttgaaagtaacctggcttcgcaatggtcaatca
ttgccactaggtagccgatttcgccctactcatgattttgattacgttgcattagaaata
ctgaccgtgtatcctgaagattccggtatttatcagtgcaaagctcaaagtgcacatgga
gaagctgttacgtcttgctccttgaaatgcatacaaattgaacggccagcaattgtggaa
agtattgccgaaactccctttattacaccaccatcatttgtggaacccatcagtggcatg
caaacggttaatgaaggagcgccagtgcattttgaatgtcgcgttcagccaagtaacgat
cctaatttatcagtacagtggtttcgcaatgaccagcctttaatgaacggccatcgattt
cggactggtcatgattttggatttgtcacaatggacattttatacagttttccagaagac
actggtcaatggacatgccgagtggcaaacagccttggcgcagaagattgccatgctaat
ttagtggttgtgccaaaacaaagtatatattctgctgcatgtcagccgaaaagtttggca
aaaattcaagaaatcgaagctgtccctcaaaagcaagatgccgaacaagaacttgtacct
gttgcaccgagtctgcttcaaccgtttgaaaacacggagcgttttgaaggccaacctgta
cactttgaatgtcgggctctaccagtgaacgatcccaaaatgataattgaatggttgcat
aatggtttgccaataaaagaaggcaaccgatttcgaaaaacgtttgattttggctacgtg
tccttggatattgcttatgtctttccagatgattctggagtatatgcatgcagagcaaga
aatgaccttggtgaagcagtagtgcaggcagagcttactgtattaagcaaaggtagcgtg
atgatggatacgactcggcctgaaagctggcataagatacaagaattagaaacggtagca
cctgcattggcagaagcagagcctgccgcagctgtgcaaccacggtttacgcaagagctg
aattcatgtacagatatgatcgaaggtcagccagctcattttgaaggcaaaatagaacct
cgcaacgatagttctctgaaagttcagtggtttcatgatggaaaaccccttccagctagt
agcagagtttcattccaaaacgactttggccttgttacattggatatagcatactgcttt
ccagaagacaaaggaatttatgagtgccatgtaagcaatgctgcgggaacaacaaagagc
acatgtgaactgcagtgtaaagcgcgctcggctattttggcagataccatgcatgaaggt
agtttagaaaaaattcgaattattgaagcgcccaaagatgtaccaccgagtcaagatgtt
gcttgtaacgagcggcctgtttttacgcagccgttgcgcaatattgatgatgttccagaa
ggtgaagcggcggtttttgagtgccgacttagacctataaatgatcctaatcttcatgtt
gaatggtatttcaatgacgagccgttgaaaatcagcaatcgcattatgccaactcaagat
tttggatatattacattgaaactagccagcactagcacattcgacacaggcgtgtatttg
tgcagagcatggaatcttttaggtgaagcggtaacgacagcgtctcttcaagtacaagta
aataatctccactgtcatgcacgacaacgagcagttgggagtttgtttcatgggatattt
ttaggcaaggaaaacattctgcgtgatagtcaacatccggaaagttatcgaaaagtgcaa
ataattgaaaatttggaaaaatttcctcgtcaagaaatagctgaaattgcttatgaaaag
ccagcgtttgagcaagtaatggaaaatttggaaaatctgaacgagggcacgttggctcgg
ttgacatgccgagtgcgaccggctgatgaccctaatttgaaaaccgaatggttcttcaac
ggaaaaccactcgcgcacagctctcgtattcatctgatgcatgaatttggttatattgct
ttggaaattgatccaattcacgtagaagactccggtgtttatacgtgcaaggcgtttaat
ggaagtggcgaagcagtcacatccgcttctgtgaaggtgcttggttctgaaagcttattg
ctgcaaacagaacacccagtcagttggaagaaaattcaaaatttagaagcaaaacctctg
gtggaagttgaagaacaggagacaattcaagagaaacctcgtattgtgcagccactgcaa
aattattctgacgttcctgaaggatctgcagtgcatttagaggcactttatgaacctgcg
aaggacaacacacttgttgctgactggctacggaatggggatctgattatagctagtcaa
ctggtgaaaacgaaatgtgaacttggccatgcaactttggatattggcaacgcttatgca
gaacaacattctggcgtttatacattgcggctgcgcaatcgtgaaggtgaagtaatgacc
tcctgctccgtaaaagttttaggaaagagcaatgtgttgaatgatacacaacatgaatcg
agctggcgccagatacaagaattagagaaacctaaagaagcggaaggaacaccagctgga
atatcatatggatcacctgtatttactgagcatctcaacaatgttgaagtcaatgaagga
gaaagcgccagttttagatgtcagtacgagcccgtcaatgacccgaacttaaaattagag
tggttgctgaacggtaagccgttggaagctagttccaaattttcagtaaattctgaattt
ggatatgtgctgatgaacatcgcctatgtctttccggaagattccggtgtatatacgtgc
aaagctataaatgcagctggtgaagtttcaacttctggtacactgaaatgtttcgagaag
gcgaacctgattttggaatcccaacgcagtggtgcaatggcaaaaattgttgaattagaa
gcaccgaagtctctgccaactgaagatgacactgtacccatgctggcaccgcagtttctt
actcctttgtctgacataacgggcatattcgaaggtcaagctgcgcacttcgagacgcgt
gttgaaccagcaaatgatccaaatctggtcataacgtggtatcacaatgacattcctgtc
gaagcaacatcgcgaatgaagcaaattaatgactttggttttgttttgtttgacatttca
tcagtcgatatgcgagacaacggccagtggacatgtgtggcgaaaaacaaagttggtcaa
gcacagtgctctgctaatatacagtgctctcctaaagcgggcattataagagattcgcag
cagccacagagtttgccgcgtattttagaactggaagcagtgaaagcaactccggaagtt
ctgcccgctgtaccacctgaagcgccaaagtttattacatgctttccgaagctggatcca
ctaactgaaggggatacggttcacttggaagcccaactggtgccagttgaagatgcaacc
atgaaagttgagtggtttcacgacaacaaaccgttgctgttaggtcacagactgaaaaca
atttatgattttggtttctgtgtattggacatcatttgcattactgcggaagacagcgga
gaatataagtgcgtggcaacaaacgcctctgggagtgactgcattagcacaacagtgact
tgtcaagcaaaaggttcactgctgttagatcccatttcgcaaacaaaagcgcaagcagtg
aaagatcttgaagacagtctccaacgcattcctgagaaggatgttcctgaagtgcttagt
atggcgcccgtatttactcatccactgcaaaatcaatcgcagttggtagatggcgacagc
gtccatctggaagcacagttaatacccgttaatgaccctgatatgaaggtggaatggttt
ttgaacggaaatcccttaaagcacggttctcgtgtaaaatgcttgaatgattttggattt
gttattttggaaattgcaccggtttacgcagaagattcaggcgaatatcactgcaaagca
actaattctcaaggtgaagctgtaacaagcgctacattagtctgtcaaccccgggagcgc
atcatacgtgagatgcagttgcccaaagaattggcaagtgcgcagaagaaaattgaagaa
ctcgaagctccaaagcagaagttggacaccacggaagagccatcttacccggccccaacg
attactcctcttactgaaacggaactggaagttaatgaaggccaagtagcacactatgag
ttcaagttggaaccgcttgatgatcctaagatgaccgttgaatggttgtacaatggtaaa
ccgctttcccacggttcacggctgaaagcactgtatgattttggatttgttgtacttgaa
cttgcaccagccgaaccacatgactctggtgaatacacctgcagggcagtcaatgctgct
ggtgaagcgtctgcgaaagtgtctcttaatgtgaaaatgaatcgcggtgttagctatgat
tggatgttgtcccaagcggatgctcgaaacaaaatcacgcagttagaagactaccttcac
agaccacctgaagaagctagcctactagagcaagattttggacagccagtttttgttcaa
gaattgtcagatttgggtgatataaatgaaggcgaagcggtacaaattgattgtcgtatt
cagcctgtcggtgatccaacaatgcgtattgaatggtggcacaacggccaccttatacct
tacagttctagaatacagactcatcataattttggttatgtagcgctgttaattcagcat
gcaattcctgaagatacaggagagtacatttgcaaagctatcaacagtaaaggcgaatct
tcttcgaagtgtatcttaacttgtagatcaagtacttcttttccgcccccgaagttcgtt
tcacctcttttggctattatttctgacgttaacgaaggtgattcagtgcacatggaatgt
cgagtgattccaataaatgatccccaactggaaatacagtggctatttaatggaaaaccg
ctgtcaactgcacacagattcaaaacgctttctgattttggctttgtaagcctggaaatt
ttgtatgctaatcctgaagatacaggtacgtacacttgccgtgcttggaacaaagctggt
gaagatagtaccgcttgtacggtatcagtgaagaaacgaccgtcgcttatttttgagcgt
caagctccgccaatatcatcgctcgacattgctcggcgcatttctcagtatacaaccaag
ccatgcgttcttagtgctgaaaatttttaccaagatagaaagtgtcaaaagccacaattt
gttagccagctagagaacacggcagtcaatgaaggtgactttgccaaattggagtgccag
ctgacgccaataaatgatcccaacatcagaatagaatggtacaaaaacaacgctcctgtt
attttgggacaacgatttatgtcaattaccgatttcggttacgttgctttggtactgctt
tacgcactaccggttgatactggtgaatatacttgcgtagcaacgaataaatttggctcg
gacaaatctgtggcgacaattgcctgtgcaccgcaaaaacgtgtgataacagattcacag
atgcctcaaggaaagtcagtagcgtctatttccagaaatgacgaaatgcttcattgggcc
gactctacggatgcacaaaacagggtaaatcaagccccagcttttacaattgcgcctact
cacattcaagccgtagaaggtcagccggctcgattcagctgtgctgtcacaggaatgcct
cagccaaaagtcagttggtttgtgaatgataaacaagcggtcaatggctcttactacaag
cttggctatgatggcatgcattacttgacaatattgaaagtccgtcctcaacatgctggg
gaagttcattgtgtggcgaaaaattccgaaggtgaggtgagaacaaccaccacattagat
gtgttcagagtggaagattttcgttctcattctcttaaacctgcaaaacgggaagatgac
atggacattgcacgacgcgaggaacaatggaagcaggaatctcttggaaaattgaaggat
gcatttgagaaagcgccaaaagcggatttgcaaaaactgatgcgaattgagaccgacaaa
cagcaaccatctcctttagaatcaaaggaactaattgacaagtttaagaaaaagaagcag
gatgatttttacgacaaaatatacttaactgaacaatccaaagtagtaccaccatcacag
ttcactgaaacggtcactcttagagctacaccgatgttggaaaaggaacttccaaaggaa
caaaagattgaatataagctacgccctgcgcctagaacaaaagcgacatctgatatgcaa
acacaaccggcctggcatcgaagcagcagacgacatcttactgatgaagaagagaatgca
ctttatcacagattgcctgaacagcagaaagagcctgaaatttttgcaagagaccttgtt
acgttgaaatctgtaaagccaaatattgctatggaaacagctgatgaaagccacatgcaa
ttagaagaacacaaattagcgtcaacgccgtcaaacaaatctcagcagacgtggactacc
aatcaagacataccatcacagcaggttactcttaagcctagctttgtccccagagctgtg
gcttcacaagaaagtggcacttttgatgttgaatccagaaaagacgcagcagcagcaatg
ttaaaaacattggaaactgaaaacacctctaagcttgtcatatcaaaggcaaagcacaat
cacgctggcgaatacacagttgtaatcaaaaatgttgccggtgaagtgaaatcgactgca
gacgtagttgtcggtgaaaaaattagcaaaggcttttcaccaaagtttatccaagagatc
gcggaggcaagtgtaattcaaggggcaacgattcgatttgacgctcgtctagctggaaag
cctattccgcaagttgtctggctaaaggatgataaacaaataatcgatgacgcccatttt
gttattacagcggatcaggatttgtattctttgataatcacagaagcgtttccacaagat
gctgggatgtatgaatgcgtagcgcgcaatgttcacggagaagcaaaatgtcatgctacg
ctcaccgttaccaagccgactgcattcaagccatctccacaggtagcaaagaatgttcaa
tcggcatcattaccgcagcttgttgtcaataaaggtgatgtggcaacattaaaaattcct
gtatctgctgaacaagtaaaatggtataaagataacaagctactttcaccggataatcgc
atatcgaccatgtgtaaggatggaatagtttcgttgataataaagaattccgatatacac
gacagtggaaattacaaagctgaaataacgtcttcgaagggcacttcagtcgctgtattt
acgatgctgtgcaaagactcacataccttttaccgttgggcttctcattcgttcccaagg
aagacaccaaagtctatgccgcttggattcaccagcccgcattcttctgatcgaatttca
gctgcagaatctatcagctatgatgacatcggttctgctctttattttgaaacggaacta
aaagatatcacaagtgaggctggaactccagtcacatttgcatgcaaacttgtgggagat
gcggagagaattgtatggcgcaaagatggtcaaattatggaagaaggggacgaatttgta
cagcagtacaacagtcacaatggatggtgcaaattaaccatttctgaagttttccccgaa
gatcaaggaattatttcatgccaagctattaataagagtaacgaatcagtaacgtcatgc
ttttttacagttcaagatttcaagtcgaatacgaaaagcaagtcagcatcagcatttcct
tcattggaaatgctgcctccgtgcatcactaagcatttggaaaccgtaaccacacctcca
aacactactgtgtgtctttttgtcgagttttactccactgccgctgcagacgttcagtgg
ttttatgaacagaaagctcttcctaattcacctaaatgcacacaaaggcgtggtaccaac
tgggcgcagttgcagcttatatcaccacaggaaggttgttacagtgtgaaagtgaccaat
gacttcggaaccgctacgagtattgcgtacataacggtgcaagaacagtggaaatcattg
gaacattccactgaaagtatcaatatcagtgaaatgattgacgttgaagcttattcgagt
gaaacgtacgaaaaaggcattgcttcgatgcatagtccatattttctgaaaaagctgcct
gataaactggcgatattaaaccgaaagctgcatctcactgcaacagttgatgctattcct
gaagcaaattttgcgtggtactttgagaacgttgaattaaaatgcagtacatcatgctac
ataacatcttggaaaaaccagtcaacaattgtgttggaaaatgcaaagcatggcaattac
aaagtagttgcaagtaatgcattaggaagctgtgaatcgacagtaactgtttacgaagac
tacttgatttcatacgtttttatgttagatgaatcagaatcgaaccgcatgagtaaattt
gccccgcaatttattaaaaagcttcacaacatgtctgtggaagctggtgaagaattgaaa
ttggtcgtagaagttctgagtgaaccagtagcctcttttaaatggtttatggacaacaac
aatgtcagcccatcaactgtcatgtcagcagataacacatctgaattacggttaattcca
gaagagggaaagactcacacatttgtcgtaaaagcagaaaatgaggttggagtagcggtc
aattctggtgttgttattgtgaagccatgccgaatatcgaaaagaatttctgatgatatt
tcatggcacagtaatgatgtttattttgaagaaacagagatgatgcatttagaaatgtct
ggtaattttccatatcaagctactcataaagaatatttggatggtgaagtggatctctat
ccactggcttccacaaaatctgcagaaaaagtcatctctgatcaaacacagccttcgcat
acagatttagcccctaaaattattctgcctttggaaaataaaacagcttcttcgactgaa
aatattacactttcttgcaagatttattctgcggtagcgtacgcaatattatggtaccat
gaaaatcatcgtttgattgatagtgaagaaacacaaatagtggtgaaagatgatggatca
caactgataatcttgaaacgtccctcagaaacagatgcgggattatatacatgcttggct
gtaaacaactatgggacggcttcaacaagttctagattgaccataatgaagcctgcttta
ccattcacatatcaacaagaaatgagagatttgtattctacaagcatggaagccattgag
atatgccaagagacagatgtagtgcaacagaaaaaagtgacaattgaatccacaatgcca
caattgcaatcgagtggagcgctgagagcagtttcacaaacagaatttacagcaaatgct
aatctctcagcgaatgactttgaagtatctactgtaatacagcatttttcaaaagaatat
gcctcagctgacatttctcaaagtgtaatgaaagaaacaaatgaagagatggaatatcga
gcagaaattacaaaaccgccctatgatgacacccttaatttgtattctatttcagctgca
agtacaaaaccttcatttacagatgttccagtttttggtatggaaaggacaatacatatg
gaaatatttgaagagatcaaaataacagagagtagacagaaagcaacacatcagactgaa
acagttaacattgaatttgaattttgtacatctccctctgaagaagtgtacatcaatctg
gatgcagagtgtttttcatgcggatcacgtatacatttgaaaggaagcatgccagaatgc
aaagaaatcactttcgaacaacgtaatattgaagaaatgactatattatatgaagaaacc
acttcaatacgatattattcttctacagtaacatctcatgaagaagaactgtcaagtgcg
tctgatttgtacatagacaagctcaccggtccgttatctctttatagtgaagagtccatt
gatggaaatttctcatttaaactcattgtggtatctgaatgtgcgcatacagttcctctg
tgccgtgagttatcattcatggtggcagtttcttatgctgaacacgaatggaatacagtt
gttcgaataatacaagaagaaacacatcaatatgaggaagaatgtttgacgtcatatttt
actgctgcaaccaaaccagcattgatgccccaagctgactacgttagtcctgtaattgca
actaaagccatccaactggaagtgactgatgcaaaagaaattcatgaaaaaatactttct
gaccactcgataacattgcatatggatgtctgtttggaagctatgaataatgcctcagct
tatacgctgcttacaaccagtgatagatttgtgtgcacagctacaatacatactgaagga
gaacagaaagcagaagaaattacaaagacagtgtcagaaatcacacacgaagaggttctc
tgcgtcattgagacacagattcgttctgagatttctgaatctgaacaaaccatttatctg
gaaatcctgtgtccatcatctgttcactattgtaatctcctcgttaagtgtggcgaaatt
ctgcagacaatggcaaatgtctacctggaatcaaaaacggtaactttgcttatcgacaat
ataagtaaagtacgtgaagaatacaatgaacaatacagtgcgccagagctcgtcttggaa
agactaccacagcaacagctcattcaaagagcagcttcatccacagaagcagctgttcac
aaatcaatgaacgcttgtcacatgacagaaaaatttaccacaattgtattggtaaacaaa
aattctgaagaaatcgaagaggttttaaagatttctacaaaaccattagaagaggtacat
gtccatgaaatggttaattcgttccagctggctgttgataaagaagaacacttacaggaa
acatgttcgtttcaagtacccagaagaatattgcaaactgtagaaattattgaagatgaa
tgcttagaagaaataacagtacatcaacagcgcactgtaagtacaatgcttgacatgctt
gttcaactggaaataccatcgcagcaatttctttgtgacatcgaagttcaactctcacta
actgcctcctgtgaagcaaatctgttaaaaggtaaggaagaaacggttaaaacagagcag
tcgattaaatgggtagtagaggaatgtactcaggaaagctttgtggagatagtgctagaa
gaagccaaacatatcgaattgcgtgtaactgaacaacatttggatatccagattaactgt
catgacattaataattccgtggctgctctgttaatgttttttgaatggtgtgaagcgacc
ttcaacgtccaggaagttttgccattatcgaaagtgtacgaacaacagaaaactctaact
acttcatctacatcagttgaaagcatactgatttctaaacagacaaagtatgaatatgtg
gagacgaccattacaggagatgttctgcttcaccgaccgtctgattactttgaactgata
gtctgtattgatggagttaacgtggaagctatattttgcaaagcttctttagtggaaaac
gcgattaattttcaacaggttgctctgcaaagaagagaatgctttgatgtttcactacca
gtgaaaacatttactgagcagtgtgtaagagtgactaaaattcaagaaattgagaaagtt
gtttgtgaatttgaacacatagtatttgacagttttcaaacaactgtggattattccatg
gaagctaatctactcgttgacataagtaagccatcttgtgctttccattcttccattatt
gtaatgctttgtgactccagtcatgcaacgatgagtataatcaacagacaagaggaaagc
acttcttctattacaacaccgtataatgaatcgatgtttgaagcaaacctaaggctcatc
atttcaactgatgatagtatcagttcgacgacatcagaaatggaacaaggaattgtatca
agtatggaggtcagttctattgcagaggaagcagttgttctatcagattcgtctgtacat
aaaatggaagctacacatgttgtttcagatgaaggcaaaactttggctattgatattcat
aatccagtttctgctgctttttccacggcttgcatagaggacatttctattttcagtgta
gaagaaacaaacgtggtttgccaagattggcaatgttcttataaatttgcatgtccaagc
aaagtttccaaaacacttgtgattgttgaaagtgacatgtgtgacagtgcaaagttcact
actacggacaaaacagtggagttttcatacatggaactgatagacatttgtgatttagca
ataactattttgaatggcatggagtattcaagccctacgatggttttgcgtatatctgca
actgataaaactgcattatttcatcacttaacgcaaagttctgaaatcaaagtactgatt
gatgttgaagcaaataattcgacgaggttacttactgctttcgagtttgatactattgca
tcagaattagaaaatcgatcattttggtccgctatgtgtataatagaaaattatgaaaat
gcggagagcttcttggccgtggaaatggccagaatcaaaaagcagagtatacacgaggtt
tcagaagaaatatctgtagtcatagaacagctacactacgaagaaaaagcttgtgaaata
acgtttgaaagcaagcgcttatcttcagcatcttttaattttaagtggaaagatgatcta
ctgtatgatgttactttgaaaaatcatttaactttatcagaggctattgcatgcgtaatc
agttgcatggatatcgaggcagcgaagatatatttttatgaagtgatttcaactaagatg
cttctaaataattcaacggcagagaattcagtgataacactacagtactgccatccgcta
actcagcttttgaagactcatttaactcacgcagatatcagttctctaaaagaggtatta
cctatactaaaaacagaaataacagcatcagaaatgataaaagaagatgttgagtcaaat
ctactttgtgccacaactgcagtaacagaattaattaatgcaacgattgattatgaattg
attaaggaggtttccgcttctgtccatacacgtgcagcagatgctgaagtttcaaaggat
accccaaccgttacattgaaagaaacttattcagagaatcagcaagattcagatgtgaca
gtagaattactatgctcatcaaaatcatgttccgctgaagcaataatatttccatacgtg
tgggaatcatgtgtgaaacagcaagatttgcattccattaatttcactgctgttgcaaat
cttaaatcagagtctcttagaacagaatgcttaatatccccatttttaaatgaaactacg
tcagtttctgtgagaattcaaacaggtcgtctcaatcagtccagcgtaaccgtgaattta
gcaaaagaaaatatgaaagatcacgttcatgcggtagtaacaagtcttgattttcaacag
ctgaaaccattcaaagcttgttgccctcaaaaacatctgacatcagtagacttttgcgca
tcaaagaaatttgaaatatacaacacattggccactactataattcctgaaacatgcctt
cttgattacaatacaactttgataataaccaagaagaatgaaactgtcactgaagaaaca
atgacagaaacaactgtgaattcttttgaattaccagatttacgaaatgctgcggaaaca
cagtttacctcgttggaacacacagctattgacactttcctagagaaaatgccattctac
ggagaatgtggtgccaaaattgaatgctctgatacgcaaagtggggttatgcagcatgga
agtcacgtgtgtgtggtagaacgcgaatttgaatgcaaagatgctccaatgcttacagca
tgcctaattgaagcagccactgataaatgttacacacaataccttcatgactcatttaag
aagagtttttatgatttcttactaacgcatgttgaaagcaaagaagaatgtgaagttgta
cttaaaatggacacatgccttgaagaagaaggaacattatatgacaacgtagtagaaaat
gtttgcgttgattcattttttcaaactgttgcaaaacctcacagcactacggaattaaga
gatctacatgcaatttcatcatgcatcagccgttttaaatctgaagaaagtcctgttgtg
acacatcagtggatacaagcattttcaactgaagctaagtgtacaattgaagaatctgtt
tctgacattatctcagcaaacgtgaccttgcgtactaaggactttgagtatgcagaatgc
tccattgaatgtgaatttcgatctgcagtggaaatggagcaaacatatggatgcattgaa
aatgctgaaaatgcatgtctatcaatggtgtatgacatcaaaaaaatgttacctgcttct
cattacgtttcgcacgatatttcaatcacgccagagttgcaattacaagaagtcagtgtg
caagagataacagaacaggcagaatttactcataaagaattactcgatgcgtcagaggtt
attcaaattgttccttctggaacaattttgcggtatgttgtagactgtgcatatgaggaa
aattcgatttctttccaggcatcaaatatcatcagtgattgtgaaatggctaaatgtctt
gaagcaaaccagcagtctgtgataacgtttgtcttctcctgtgatatttcaaatattaca
acgcattacagaacgtcttcagtgactgacactattgaagcagctattccggaatacagt
catgagacatgggaatttgcatctgcagacgtttgtagttttgagaaatacatttcagta
tcaccctgttcctctgcatttgcagaatacgcgagagcaggacaagcgtatattaacatc
ttaagcgtgttggaatgtgcttccattacagaaaacattgcaatggaaaacctttcaaaa
tgtgatggatgtcagcatgttatcagtcacctacttaaagaaacgtatggttcatgccac
aacgtattatcaaaggcgttcatcaacacaagctcagcctcagatgaatctcagctgatt
ataaacttcctaaaacagacggcggatgcaaaagatttcaaaatccaatacgaagaatgc
tcagtaagaacagattacttgggagaatcatcaactgtgatagaatgcactgtgcaagaa
gtacagcaagaatctgttttcaaattgctcaaattatcatcaatgctaaatgaaaagcat
ttcgactcatcattggaaagtgatcagcatttcagatcttgtcaatgcacggtacattct
cttgtaatggaaactgcttctttagctattactctggaggaaacatgtgctgactttggc
gtttctccacctgtcgctgatgagctaatcaccaaatctcattcaacgcatcccttttct
attagtgaaaagcaagaaaagttcactgtggtcgctactgatattaatcttgattcctcg
ttgagctctagttcagttgaatacaccacaacagcactacagagaatgtctgatgcaaca
cttcacgaaataatcaacgtttctaatgactttctgtgtaaacgggaaaacattttcgat
gaagatgaaattctgcataaatatgttctccaagaaacaatttttcaatctgcagaaaaa
actgatctatcagtgtcaatggagaagactgaagaaagtgaacaatgcacatttaccaga
tggagttccgttgttgcttgcaccgtaccaatctattattctgtttcaaaaatggcagaa
gaaattccaattccagcactgccttcaatgaaagaaaccactgtagaagttctattggaa
aagcctctatcagtcttagaatgtcattttaattttacagacttcccttcggtaatcagt
tatttaggactgaatcgacagctgataacttgtttcaacgtcaaaccagaagcatttgaa
aagataagcacttcatgggcagacgttgatgtgcttgcacaagatatgtctttgacggat
aattcaaaagaagaaacgtattctattgaaaataaacagcgcagtgaaagtgaaattcac
tattcaacagatgaagaaaaatgtcttcaagcttcatatgaggaagtttacaacaatgtc
attctggaaaggacttcagtggaagcacttgaaattccaatgaaaagcgaagaaattata
aaatgctcctctgaacacgtatattgtgaaataactttcgttctaaaggaagataacaaa
tccgctcaaagctacatgtcttcgtgtaattttgagtcagaatcagcatttatatcctta
attgaaaaagatctaacttgcactgtcaaagcgtgcaatttagcagaaaaccaaaacatt
ctctcctcagaattattggaaaaatttgaaaatcatgttacgaccaactacatagatgag
gttgctcaatttcagcacgatgatgaacttcaagatgcggtcacattgaatgcaaaagac
aatgtaattgcaggattgcaattaacaacgacacaaaaatttgaaaacgttatgttagaa
gtatcatggctgcatcagttggaatttggtgacttacaaagcatcattgaacaacctgac
cgtatcgttacagatattcatattcagccaatttcaccaaagcagacacaagaagtgctg
gaagttattcaaactactgatgaagaaaaatttcagagtataagctgttcaagtaacttt
acacaagagaacgagttcaaaaatgatatcatatgttctgaagcaaacaaagagcacgcc
atgctttacttacacttggtcgacacccctgcaagacaagatgtatttggacaagcaccg
gaatttactcttcacctttgcaatactgaaattgccgagggaagtcatgttcgactgaaa
tgcattgtcagtggacaaccgaccccagatatacaatggtttgtcgatggggatcagttg
gcatcgtcagaagatttcaacattatttatgaagatggtgtttctgtgttaaacataaaa
gaagtgtttcctgaagatgaaggagaatacagctgtgaagccgttaatcagtttggtacc
gcacgcacagcagcctatttagcagttatccctgtggaaaaacaggcttcagcaacagat
aaagaatgtactgaatgttatggaaaagaatttgctaatgatgaatggccagtagaaact
gtcacaatgtcgcaagaatgctggagcatgctaaaatctgaagcaagttgtgaagctgat
gtggctgttcgcatcaccgacctagaacagctaaaatgtctatcacctataagtgatgga
atagctgagattgtcgcttctcacttggcagaaaccaatgaagtgtttgtctatgggtcc
accaaatccatggaagatacgtcattcactcatatttcagaaaaggcagttgagagtgta
gcagagcatacactgaacatgcgtgaaaattttgctgaagtcaatacattagtgtccttg
tcgttagatgctaatcagaatatatcactgcaggttgttttaaaacaaccgcgcgttgcg
tcacttgttttctgtctgacttctctgacaaaacctattttgcccacattggtgaatgat
caggaaacagcaagaaaatatggactgactttacacagcataagtgacgacagtatagca
ctcaatgtaggcaactctgagagtttcgcagattcatccgatttcaaatcatcatctcag
gatgcatttgtcagtattgacgtagacttagttcacatgggagctcgctgctgcggtatc
ttcactcttcttagtcgacctactgaatcatcaagtttgacattgactgaatgtgagctt
aaagagcttaaagttcttcaatctttacttatgttgccactcagtagagaagactgcttt
ccacttattgagcgttacataagggagtgcaaaggttacataagtatggaagcaacatta
gtgagacgtgattcagagttgagcatatccgcctgtgaaatacatctgtataggcagttc
caaaacgttcgcttaagtctagtcactgttcataaacatttagagcaaactgataacaaa
gcagaccttagcaaggaatttccgtgcaatgaagttgcctgtaactttctggacactcat
tatagccatgcaacttgtgaaatgaaattgttcaatctgaattcagaagcatttattgat
ttcaattcagtaagtgctaatgctgaatttaaggacactgaatctatgcttgtttcactt
gactttgaacaaatacaaagccagccgcatgtgcttgcgttttgcatcgataatcaaatg
ctttcgttaagcaagaattttgtatcgaggaaaggatgctactctgacgtagaaattcaa
aatataggcggcgatttagaaaccttcactaatattccacattcttcagctgattattca
tgtctagatgaaatatcgtgcagtatactaatagaaaaagcttctgaaagtatatcatgt
tcaaatacctacgcttcagcggatatgttgaatatatcaaaatgtagcctatttattccg
ttcttaaaggttgacgacagtgttgttggtgttgatgttcaaatttctaaggattggaaa
cgtattggtaatgatatcgtgtcgcttcctgagactgaaactaaccaacttccgtgtgaa
gtagcagtagctatgattatatcagaaaaaattgcaaagcatgtcggctctactgccgca
tttttatctgaacccagcttcttccatgaaatgaggactgcttctctttttcctgcaact
gtttctactactttcatttctgagaatgtgaataactgcgaaacagagaaaattttctat
tccccttccattactagacctcctacttttactgttctttccaatactatttctgcaaag
tatgaggatattgaagtattaaagttggacgagcagcatggaatacaaactgaactatat
gatatggatctttctacatcacggacaaatatgtgcttgtgtcaacgcaatgctttaatc
aggaaatgcaatgcggagaataacagagatgtgataactggccattgcagtgcaacgtta
cccgtgaagcatactgagaattatgacatagcactaacggttctttcctttaacgctaat
gctttaagctgttgtgaagttcatgaaaacattactgtgcaaaaatcggaatctagtaat
tcgttgtcagtatctcctgacagtattgcgtctaagttcacagcggtatctgattattca
aatgtcgagcagtgccttacagtgcagaataatttagagaatgatatattctttcacagt
gaattttcacaaatagaaggtgaactggtagtagcttctaatcctcatgacagctacaca
tgtatattaactgttgcaccattctacaactgcgagatgtggcgaagcgtactcgtttgc
agctgttgttatgatgcattagtggaaactgatgaagaggcaaatataactttttcctac
aacaaaactactatagaatgctgcacatcgatttctttcgcaaacagttacgtagaaatt
tactgtccagaagatgtcgcagacatcagtgttaagctcggctgcaccgctcagcagcct
tatcagcagagtctcaacgagtcccagtgcagtcttacggtgctaattgaaaaggatgaa
tcagaaagtagagaatttattgattttcctgaaaaggtccatagtgttaccaacaggagt
ttctttgcacgacaaacatttttggaagagactgttgatgtacaatttcgatcgtcagca
aataactgctttgctgaccatacatatcatgaaggtggcgacaaaagcaaatgcgctgtg
atcaaagtggaaaacaaagcagacgaagattttcaactgtttgcacaaggaataaaacaa
gattccaaagcggaaactgttgagcatataaaacagtattttgtacctcatggttcagat
accaaactaatggaaaaactatctagctcagaaaacttggtgcagtggtttattaatggc
tcgcctttagtaattacgtcacgacatattgttcatactgaaaatggctgctgcgagctg
ttcatttcaaatgttacttttgaggattctgctatttacagtattgaaacggatgcagga
tatatcaggcctgtcgcagaacttattgttgagggtaatgcacaatttttcgtgcttgca
ccattccaacgcatgtatacgtttcactttaataatccattcgaaattgttaagcatttc
tacatttcatctgattccacttctccagacttggataatgctgtcattatcactgaaaag
ccatttcagtgtgttcaacaaaatctagatgctgaactccacggtccagagcaaaatgct
aatacagatattaatatatctgaagatcagcacttctacgcttcaaagacgtatgaaata
gacattttagagaatatcatgaacttaactgctacctcaacttctgaaatagtgaacgat
attgccaaagctgaaaagatcacagatgtgaaacgtcaggaaattgttgcacataccgat
ctaacagctgacatggcactgaacctaatgcgagcagaagaaattgaactgagcatcgct
gagtcctcaaatcctgagaatgcatgcctagaggttttgaatttattcgttgcacgacag
cgtagtgatgaaacaatgctagcgacaaacactttaaatttaaaaacaccggaacaaagt
gcagcactgtgctgcagtgaagaagaaaacattacatccttatctactattaatatgaat
ttcctttttacacttggcccgctatcatgttccaaaactgcttttaattcagaaatgaag
aaaatgctacactgcgcaaatatcatcttaagcaacgctcacatgtttgcatcttatgac
gctacagaaaatcttactacagaatgttgtatagatgaatctgacacatgtgatacgcag
ttcagcagtgtagattgtggaaaaatgttgctgacctctactctcgaccagaaagatgat
gtttcctataccgcctgtgtacatcaacggttaaaagaagaaacttcaagcacgcaatca
aattttgttgactgcaatttaatccacgaaaagtctgcagatcataaggaggctgtggca
tcattttctgaacagtgttcagatacaataagttcttcagtaacgactgcaacgatcaca
aaaaaaattgtgagcattgatgatattccaataatagctgtcggttcagagatcatggaa
tctctaagaaaaccaaaaagaaaagaaaagcgaaaaataagcgaaatcactgcaaatgaa
agctttaattggaacaacgacctcaaagttgaacggatctgcatggaaatttccgttgaa
aactgcagcagttcaataaaagctgaaagtgtgcaagcattaatagaagctgaccataag
gaagaaacagagtctatatgttgtcttcatcaaccacatttctttgtagagtctgcattt
ttgttatcacagaaacagcaatctcaagaaaagcaaactttaaatattttgttttctgca
aaatttgcagtttcagaaagcaaaattctactacaagaactctgcacagcatctgaagaa
gcatatataagtattaaagagcactacgacgttcatctcacatgtaaacaaacggaagaa
gctgtcagcagcacattgtcacggactgttacagctgatgaagtggatttcgaaaataaa
aaggaagtgatagaagaaagtgcaatcatagaagaacctactaaatcctcatgtactgcg
ttcgacgtgcatgaaagtttgcatgattctggagatgcttccttccatttcacattaaaa
tatcatcagtctgcgcatataagaagagcatctgatttcagcgagctgacgtacacgata
aatctacctaatttagaaagaaaacaatacgaagaaatgcaatttcaagatgtaaactac
ctgaaatcacctgaacaattatttaaagaaactataacaactgaagagcaagtcgaaaat
gccatcctagaacattctgtcgatgatgttgctttgaaagttgaaagtcagtcaatacct
gcaaaagaaggtgcttctgctgagatagaaatcaaagatttctacaaagggacgactgtt
atgaatataattaccacagtcatgaagaaacctatttctgaagaggtcactaaaatactg
gaaattaatcaaatggctgaaaatgcatattcatgtggtcagcttgcagaatcagtgaca
aacgaaactcgagtgaaaatcacttgcaaaaagcctcaagaaattatggcagtccaggca
ctttttgcggaggtaacaactttattttcttatgaatttcatgtaggacaaagaatttgt
aaaccacttcaagaaacatcacggttactttctgctgttgatactacacaaaggtatttt
caagaaatttctgcagaagttgaatgcagagcgactgatgataatactttatcaactgaa
agaggcatagatctgtcagttcactcaatgtcatctagtgctgtttccaaaacgtttgct
gacatcaaagtggttctggagcagtctcccgcattagaaattaccttcaacttggaaaaa
atacgtgagactctgcttttcaatgtatgtgaccagtattttaaattggaattaccgcta
aaacagctcgacgccttcatgtccattttattaccttatgcagtgaacatcacccatcat
tcagctgaatgtattcttggaagtgcaattaactttgtagaaacagatgtaagaaagaaa
tcagaatgttcacactgtgtaaaagaatgcagctgtgctcctttctctggatgtgctata
tgcatttcaagagctaatgtcagtatgtctgtcattctcgacaaaccttcaacgtctcaa
tctgaggctatgataccaattgaacaaaaactgggattagaatatctggactttacatat
gcttctgaattcactgctcccattcaatctgaagaagaggcgcacctcataagtacagca
aaaacgtctcaacagctgcaacacatcaaaagcactgaaaacgttgttaacgtggatgct
aatattaatggctttgaagcaaacgctgaagtatccacaatagctttaagaaaagaattt
ttcaaggtatatcacagcgttcgtgcagatgaaatggaattcacatctgaaggctttttt
tcactgaagaataaggatcaagtggttacagaagaagcaagcactttgaacactcttgaa
atttatgagaatttcaaaagagaagatgaccattctgatgttacgttccagaaactgatt
atttatgaaatacctccgctagacgaaactctatcgttttccgtcgttgctgaggagtgc
tgcttgaaacaggcggatcattctgaatgctgtcaagcagtaattgcagaaaacaaggtc
tgtttaagccatttccaattcaagcatgtaaaagatcatatccactcatgtagctgtgat
atttatttttctaaagaaagtgaagtagctccttgcactgtgcagctaggaaaattgcta
cttcagtgtacgatgtccgaatcaagctgcttcctctacattccgaatggaagtagtctt
gcagctgaaactgaattattggatgcacaggcagttaaaattccagctttggaaatccta
cacactgaatgtgcctgtgaaaaggtttcgtcatggaaaggaaacatagagcttcctgtg
aaagaaaaaatatgcgtcagtgattttcttctcaaagattacatcaattcagatttcgat
attacagtacgcattgattccagtcatgcctcgtatgcaatcaaaaacatttgtattgtt
gcaagtgacttagaaaaaattaccgtatcctccatctgcacttgctttgaaaaaggaagt
atagaagaaatgacagaggaaatatttgctgaaagtttacttggaatccgaaaatatcgg
cacagacatctcaaggatttcacagaagcagcgtgctattgcatagctttaacaaagcat
caagaaagcttatcctgcatttcttcctattttacatcagtacgggaaagttgcttcgct
gatataaagcatttaaaattggttgaaaactacattaagcctaccacggaagaagcaact
gaatatgattatgtcagcgtttcaacagctgagaaagtggatgtcagcactattatggct
tccagtacttttctggaaaaagaaataagcgccttatgtgatataacctttgagaagaaa
gcagacatttccagcagcaatgaatttgtcatgcataccaaaagtacaacaaatgcagta
tttagtgttgaaggcaatgcgttttatcatgtttcagctgaactaagcctctctcataaa
agtgaaaaggatgaaatatatgaacaagaagatgcatcatactgcacgtgttcaatagat
gcatccctagaaaaattaccatcaaaagattatgcatatgcatttgtcgatctgagtaat
tatggaaaacgagtattcacgttcaagcatttccgagacattattgaagcttcaagtgta
tcatctagtttacaaagacatcctcctgagaaacctgaactttttgttgagaaccttttc
gcgacttcttctgatattatctatacttcagaaaaggttaactttcaactgctgcttgaa
gcaaaaacttctataactaccatatttacacgacagttattaaacgacgtctgcagtatt
acattaccacaaatgaaccagtttgaagagcttgtcaccagtgttaaaatagcaccagtt
attccaactgcacatctgacagttactagattaagcgatcattcagtaaacctcgaatgg
aaccatccatcagaaacgacagaagataatattgatggatacgatgtgctgctgaaaggc
gaaacggatgatgaatggtcagtagtggcaattctggatcgcagtcaaacccactgcata
ctggaagacttgaccaattcatatacttataagtttgctatccgaatacgaaaagaagat
gcacagagcgaattgctggaaacagaaagtgaagtatacgttcaaagtcgtgccgtatcc
ttaccgaaacggccaaaaggtccacttaaagttaacgttaaaactatgagttcgatatat
gttgaatggaaccctgctgacgctgaagatttcatgaatatttccagttatgttgttcta
attcgagaaagccagcgtacaacatggcttgaagttgcaacggtgggtcctgaagaaaca
cgctgccatgttagcgacttgaactcaggatctgagtatcacgtccgcgttatagcagta
aattcattaggaatttccgaaccactagaaacggaacaccccattttaatggaacgcata
ccaacgttattaactccgccatcgccgtgcaaaccgccgcttaatgttctctccgtacac
aatacatcagttactttgcaatggaatccaccagaagatgacggtggttctccaattaca
ggatacgtcatttctagacgacatttagctcagaaacattgggaagaagttgaaagatta
cctgaatttgtcctcgaatacacagtgtcgaatttgaagcaaaatgcaagataccttttc
cgtgtaaatgccgtaaacagtatcggtatcagcgaaggaacacaaacaactgagccagtg
aacataagaaaatggaaagataaaccaggtgctcctggaaaaccaacggtgaaagaattg
aatgctgattttattgttttacaatggagtccaccagaagcggctaacaatgcaactgtt
actaattatattgtggaacggagagatgaaggatgtgttcgaaaaaattggcttgttgtt
tccagaggaatgaacccaaatgctgaattacttgtagagcgcctcattccaggaaatacg
tacacatttcgagtttcagccgaaaacgattcaggaattggtccagctagtgaaatctca
gataatattaccttacctctaaaaactgtaggtatcgcaccaaactttctgactctacta
gaagatacttcagtttttgaaaatgaagatataacgttcaatgtacagttttgtggtcaa
ccagcgccacacattaaatggtataaaaatggtcgtgaaatatgcagtgatgaaaagcat
cgcatttcgactgctaaaaatcattcatcatttcaactgctaaacgcctcagaaaacgac
gaaggtgaaattgccattgaagcagaaaattgtcatggaactgtgactcaatcagcgcaa
ctcaaattaaaagctgtggccaaaattatccgcaacgaaattacccaaaatgaactgctt
cgtggcattggtgaaacagcgcatgtcagctttgaagttaaaggaagcccactgcctacg
gtcacttgggaaaaagaccaccagcagttgacagttagtaaccgcgtatctgtacaatca
gatggaccaagtcaatcacttgaaatttcacagtgcacttatgaagattcaggtatttat
acattgagagcagcgaatatttatggtgaagatagtattgatgtaaaaattaaaatcacc
ggtgcaccatcttcacctggaaagccagttgtacttgaatgcgacgaagaaagcatcacg
atcagttggacaccaccgttatacaatggtgaagctgaaatcacgttatactatgttgag
agtcttggagtgggcaatgattggactgtttttggaacgacaaaacaagaaaaattaacc
gcttcatttactgttgaagaaacaccagtgaaattcagagtaaaagcggaaaatgtacat
ggaatatcagaaccaagcgaagcaactatctggacccggatgttagagcagaccgaagat
atcacagttaatcttacttttcaacaatacaaagaaaaacagcaacgacaaatgagcgaa
ttcgattcattggttttaccagtacccccaacatcccttcacaaaactgatggtcaatta
cctggcaatttttatgacaagtacactttgtgtgaagaactaggccgcggtgcttacggc
gtcgtttacagagcaattgaaaacgcaactggacttacatttgctgcaaaaattatccaa
actcgaccaggaattcctaaggataatgttttgcatgaaattgacatcatgagtcagctg
aatcacccatccttgctcacgttacacgaagcgtttgacatgaactcagaaatgattctt
gttcttgaattcgtttctggtggtgaattgtttgatcaactgttggaaggaaaagaaaac
ttaccggaaaaagaagtgcgcgaatatattcgccaaatattgcatggcatcgaacacatg
catcagaagcagattgtgcatttggatttaaagcctgaaaatattttgctgagtacgtca
ttctcaaaggatattaaaataattgacttcgggttggcgtccaaactgaagaaaaataaa
agcgtgcaattattattcgggacaccggaattttgcgcccctgaggtagtcaatcaccag
tcggccagcttttgtacggatatgtggtcagttggagtcattgcttattgcatgttaagc
ggtatttcaccgtttgctggcgacacagatgaagaaactcttgccaatgtatctgtcgca
gattggaattttgatgacagcatatggacacaagtctctgacactgctaaagattttgtt
agcaaactcatgaccaagaataaaaaaacaattttttcccttgcttttacctattttgca
tttatgcagtttgaaaaccatcgtcaaatgcattatcaaattgaacgttcaaaaatttat
tttagtaacagaatgacagtggaagaagcattgcaacatccttggataacggaagagcct
gcagaagttacagaaattgcagcacctgaagagcgaccagttccccagcttaagcttaag
aaagattctattacaaaacgtcgatggtctgatgaattgcttccaattggaaagcttgct
aaacacagtgctatactgagacaagcttcgatggatggagtatttgaaagagaattgcat
ttagaagttcccgataaaattccaaatatcattgcgaagcttgaaaataccgttgctgaa
gcaggtgatctggttgtcaaactgaaatgtacagtcgatggcagtccccgacctaatatt
tcatggtttaaaaatggaatagaaataaccacttcgaagaagtacaaaattttccatgat
aacactaatgcagagttgaatatttccaatatcagtgaagatgatgaagccgtatatagt
tgcaaagcagaaaacaaatttggatatgcagaaacagcagcccgtttgacagtaaaaaaa
gtagacaaagaagatagcttgaaacgcagtgattctgtgccaacattcttttcttgtcct
tatgatcaaaacgtaatggttggagaatcgtttgacctacttgtccatgttggtggaaag
cctttcccacagttaaaatggtacaaaaacggaaaacaaataaacgacacgtccgaaaag
taccgaatacaacgctttgacgacaaagaatgcattactattcagtcatttcaaaaagat
gatgctggtttgtggcagtgcattgccattaatgatcttggcacttgtgaagtgaaattt
cgactgacacttaaatatccagaagaattctgcccgccaaaaataattgaaaatttgaaa
gatatttctgttgaaaatgggcaatcttttcaattgcagttacttattgaggccaatcct
ttgcctgagataaaatggtataagaacaatactgaaattcaccatggagaacactacaag
atgtattttgatgacaaaaactcaacatatgcgctcagtgtaaatccagcctacgttgaa
gattctggaatttttaaatgtgtaattactaacataattggaagtgatgaaacatcttgc
aaagtcactgttgaaggtgaagtcgagaatgcacattatcctgaattcttgcaaattctt
acggatgttactgtcgaagaaaattcacaaattgcattggaatgtcttgtagaaggtatt
ccatttccaaaaataacctggtacaaaaatgatcgcgaaattgaaatgactaatcgcatg
atgtacacagaagatattagtggtcattgcgctttgcgaattttaaatgcaaatgaaaaa
gatgctggaatttatttgtgccgtgccaagaacattgccggcgaaacgaccactcagtgt
gttgtcacagttgttgatgtgaaatgcaagcggtcaataaacattcctgacgaaagcgag
ttggaaagcgaaaaacaaatcgtcgaaccactacacattgttcaacctctgcaagatgtt
tttgctactgctggaaaatccattttaatggaatgtgaaataagcagtagcccgagggct
tcagttcaatggtttaaaaacgggcagtttataacagaaaatgcaaatatgcgtcttgtt
ttcgatggacgcaaagcgactctgcgtatcattgaagcatccattgatgaacatcaaggc
gaatatatctgcagagcaactgcattggattcagtagtggaaactagagacgaaggagaa
gaacaacattcagacttgcgtttcacttcaattcctgaacaagcagctccaattgtgtat
tctgaagttgaagatattcagaatgttttaaaaagaccagtagcggatgacgtggaattg
acttggagcgacaaagagacacttattgactcattttacataactgaagttgaaaaaacc
agcttgactttgtgttggtcagaaaagggtcaacatcacgaagcagctttgtataaaatt
tttgtccggccacaacatgctagcaaatggactgaagttggaataacaaaaaatagtgca
ttccatgttatcaatttgcaagaggatactgagtacgaatttcttgttactgctaaacgg
cagaaagaatgggaaaagccagtccaattatccgttcctgcagacaaatctaaaatacga
actttgcccaaactgcattgtctatccgatttgaatgtaaaattgaatgtgggagaaaaa
ttgaaaatagtttgtcaggttgatggaaatgtgacatcagtaattacctgctataaaggt
aataccaaaatacaagacgatgatcggatcattgtacagcaccaaaatgatggtactata
ctgctgatgattgagtcagttcaagaaaatgattgtggatcttatactatatatgcggaa
aatgagtatggtttttcttaccaaacggttaccgttactgtcacttctgctaatgttata
tcagaacagagagaaactccgaacattccgtgcattcttcatcctctagttaaccaaaca
ttacgtaccggaaaaacagcaacattaacatgccgtgttcgttgcataccacctggaaaa
attagatggtacaaaaacggtcagaaactaaaatctggcaatcgctatcaacttctcgcc
tccaagcatcaagcgtatcgattaatgattcacaatgtcgatgaagaggacaccggatta
taccaaatggcggtggagaatgaatatggccgtgccagtacagaatgcatgctgacagta
aaaggtggagttcaacacaaggccccatttgttgaaaaatccttggaagatgttcgcacg
aatgttggaagcaaagttgtattaaaatgcaaaatcacaggccaaccaaatccgtcaata
atctggcttaaagatggacagaagctgaaaagttctcgggatattcaactaaattttgat
gataacaattgcatgctcattattcattctgccgcagtggaaaacactggtctgtacgca
tgctctgctaccaatcttgtcggcactgtcaacactgaatgtcgtttattagttgaagtt
ccccctgataatatactgtccaaatacaaagcgcctgtatttacgctaacaccagagctg
aggcttgcagcgctggaaaatgaaaatattcatttgcaatttgaaacgtattctgatctt
ccagtgcgctttacctgtctgaaaaacaaactcccggcagatgctggcagattaaacact
cagatttacgaaggaacacatatgtcatggacgattaataacgcaatgatatcagatagc
ggcgagtacacttgtattgcagaaaacgatgtcggcagttcagagtttacatttaaaata
tggatcacaaatttatcacagtgcagcgatgaagaaatgcaagagctgaaagaaaagtaa

DBGET integrated database retrieval system