KEGG   Trichinella spiralis: Tsp_05770Help
Entry
Tsp_05770         CDS       T01609                                 

Definition
(RefSeq) stress-activated protein kinase JNK
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
tsp  Trichinella spiralis
Pathway
tsp04010  MAPK signaling pathway
tsp04012  ErbB signaling pathway
tsp04068  FoxO signaling pathway
tsp04137  Mitophagy - animal
tsp04140  Autophagy - animal
tsp04141  Protein processing in endoplasmic reticulum
tsp04212  Longevity regulating pathway - worm
tsp04215  Apoptosis - multiple species
tsp04310  Wnt signaling pathway
tsp04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Tsp_05770
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    Tsp_05770
   04012 ErbB signaling pathway
    Tsp_05770
   04310 Wnt signaling pathway
    Tsp_05770
   04068 FoxO signaling pathway
    Tsp_05770
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    Tsp_05770
   04137 Mitophagy - animal
    Tsp_05770
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    Tsp_05770
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    Tsp_05770
  09149 Aging
   04212 Longevity regulating pathway - worm
    Tsp_05770
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    Tsp_05770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tsp01001]
    Tsp_05770
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Tsp_05770
Protein kinases [BR:tsp01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   Tsp_05770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH RIO1
Motif
Other DBs
NCBI-GeneID: 10910417
NCBI-ProteinID: XP_003380044
Position
Unknown
AA seq 447 aa AA seqDB search
MANRWIGWPREGKEQLQAQPLASSTFASVLSTSSKKRNSGTNTKQQSSQTACSGHWSPRL
APMSNVNGSSSSASSASSAARLNHNQDQFYQIEVSDTRMLILKRAANDIVSGRNVAIKKL
SRPFQNVTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQKMLEEFADLYIVMELMDANLCQ
VIQMELDHERMSYLLYQMLCGIRHLHAAGIIHRDLKPSNIVVKSDCSLKILDFGLARSAG
NSFMMTPYVVTRYYRAPEVILGMGYKENEEFTNSSQFFFVPVDIWSVGCIFGEMIRGNVL
FPGTDHIDQWSKITEQLGTPSADFMRRLQPTVRHFVENRSRHSGFAFDRLFPDRMFPKNS
SDLRLSAQQARDLLSKMLVIDPEKRISVDDALQHPYVNVWFDESEPPPAKYDHAVDEQEH
SVDQWKELIFREIMDYEESHDVYGTTF
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacagatggatcggatggcccagggaaggcaaggagcagttgcaagcgcagcct
cttgcttcttcaacgtttgcttcggttttgtcaacgtcgtcgaaaaagcgtaacagcggc
acaaacacaaagcagcagtcaagtcagacggcttgtagtggtcattggtcacctcgattg
gcacccatgtcgaacgtcaacggttcatcctcatctgcatcgtcggcgtcgtcggccgca
cggctcaatcacaaccaggaccaattttaccaaattgaagtcagcgacactagaatgctg
attttgaaacgcgctgccaacgacattgttagtggacgtaatgtcgccatcaagaaactc
agtcggccgtttcaaaacgttacccatgctaagcgagcctatcgtgagttcaaactgatg
aagttggtcaatcataagaatattattggtctgttgaatgcattcactccacaaaaaatg
ctcgaagaatttgccgatctgtacatagtgatggaactgatggatgctaatctctgccaa
gtgattcaaatggaacttgatcatgaaaggatgtcctatttgctttatcaaatgctttgc
ggcattaggcatctgcacgctgccggtataattcaccgagatcttaaacctagcaatatt
gtagtgaagagcgattgctctttgaaaattctcgactttggtctagccagatcggccggt
aacagtttcatgatgactccgtacgtggtcactcgttattatcgtgctcctgaagtaatt
ctcggcatgggatacaaagagaatgaagaattcactaattcaagccagttttttttcgtt
ccagttgacatctggtcagtgggttgtatttttggagaaatgatccggggaaatgtgctt
tttcctggcactgatcatattgaccagtggagcaagattaccgaacagttgggcacacca
tctgcggactttatgcgacgactgcagccaacagttcgtcattttgtagaaaatcgtagt
cgacatagtggttttgcttttgatcgactttttcctgatcgcatgtttccaaaaaatagt
tctgatttacgtttatccgcgcagcaagctagagatttattgtcgaaaatgttggtcatc
gacccggagaaacgcatctctgttgatgacgcattacagcatccctatgtgaacgtgtgg
ttcgatgaaagtgaaccaccgccggcaaaatatgatcatgctgttgatgagcaagagcat
tcggtggatcagtggaaagaactgattttccgggaaattatggattacgaagagtctcac
gacgtatacggtacaacattttga

DBGET integrated database retrieval system