KEGG   Trichinella spiralis: Tsp_09051Help
Entry
Tsp_09051         CDS       T01609                                 

Definition
(RefSeq) deoxyribonuclease II family protein
  KO
K01158  deoxyribonuclease II [EC:3.1.22.1]
Organism
tsp  Trichinella spiralis
Pathway
tsp04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    Tsp_09051
Enzymes [BR:tsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.22  Endodeoxyribonucleases producing 3'-phosphomonoesters
    3.1.22.1  deoxyribonuclease II
     Tsp_09051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNase_II ANAPC9
Motif
Other DBs
NCBI-GeneID: 10902769
NCBI-ProteinID: XP_003382203
Position
Unknown
AA seq 321 aa AA seqDB search
MKRLTKEFTNLSIFLYRVVVYKAPAQNMGKALIAGRAPVVWQNTPDLTQPNNHAVVKSLE
HVIAVNPTNKFIAYNNIPPDIPKVKTKSNSKGVLMMNPGVPDEASWIVHTIPGFPKALTG
YVFPPAEIQKGHLFICLTIKESEIDAIAMALRIATPLIYHNDIPDDPARPNLKKLVNGES
RLTPPLTVTQQISTAAAQGLKMTIYSKSEKSKYEIYRRVLVKKLKTSIRAWTTRDKTLKS
DCRILNRNIKLVASPIDVNGHASSLDSDVSQWLISDPGNKFCAIDKPYHKSQTKEPAMAV
CIDDATIFGHFNLIGQNVENC
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgattaacaaaagaattcaccaacttgtcaattttcctatatagggttgttgta
tacaaagcaccagctcaaaatatgggaaaagcattaattgcaggacgtgctcccgttgta
tggcaaaatactccggatcttacccagcctaataatcacgcagttgttaaatcacttgaa
catgttatcgcagtaaatccaacaaacaaatttattgcatacaataacattccacctgat
attcccaaagtaaaaacgaaatcaaacagcaaaggtgttttaatgatgaatcccggtgtc
ccagatgaagcatcatggattgttcacacaataccaggtttcccgaaagcgctaacagga
tacgtatttccacctgcagaaattcagaaaggacatttgtttatctgtttgacaattaaa
gaaagcgaaattgatgcaattgcgatggccctgagaattgcaacaccactgatatatcac
aatgatataccagatgatccagctcgaccaaatctgaaaaaattggttaatggcgaatca
agattaacgccaccattaaccgtgacacagcaaatttctacagcagctgctcaaggatta
aaaatgacaatatacagtaaaagtgaaaaatcaaaatatgagatttaccgaagagtactt
gtgaagaaattaaagacaagcatcagagcttggacaacaagagataaaacattgaaaagt
gattgtcggattttgaacagaaatataaaattagtggcaagtcccattgatgttaatggt
catgcaagttctcttgatagtgatgtttctcagtggttaattagtgatcctggaaacaaa
ttttgtgcaattgacaaaccttaccataaaagccaaacaaaagaaccagcaatggcggtt
tgcattgatgatgctacaatttttggtcattttaatctaattggtcaaaatgtagaaaat
tgctaa

DBGET integrated database retrieval system