KEGG   Trichinella spiralis: Tsp_09712Help
Entry
Tsp_09712         CDS       T01609                                 

Definition
(RefSeq) putative protein kinase domain protein
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
tsp  Trichinella spiralis
Pathway
tsp04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    Tsp_09712
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tsp01001]
    Tsp_09712
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tsp03036]
    Tsp_09712
Enzymes [BR:tsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Tsp_09712
Protein kinases [BR:tsp01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   Tsp_09712
Chromosome and associated proteins [BR:tsp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    Tsp_09712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 APH Pkinase_C Fapy_DNA_glyco Filament
Motif
Other DBs
NCBI-GeneID: 10898386
NCBI-ProteinID: XP_003374406
UniProt: E5SP37
Position
Unknown
AA seq 1114 aa AA seqDB search
MRMRASHFTLIKVIGRGAFGEIKRADSAFFWEERDIMAYADPMWIVKLHYAFQDLKYLYM
VMEYMPGGDLVNLMANYDVPEKWAKFYTAEVVLGLDAIHSMGYIHRDVKPDNMLISASGH
VKLADFGTCVKMDSDGLVRCSTAVGTPDYISPEVLRSQGSEGVYGRECDWWSVGVFIYEM
LVGETPFYATSLVATYSKIMNHQSTLTFPDDVSISDAAKDIICKFLSNRNVRLGRQGVAE
IKSHTFFVNDEWDWNTIQNSNVGKIFCMLSPLRLDDWFKFLARPPVVPDLTGDDDTRNFD
NIEKEGLPQESFQLPRAFAGNQLPFIGFTYSREFSPMACLAVSQQTLADAKSDLQRLSMQ
NEQYASELGLVQETKKLADACLQQVNADSSSIEFDCLKLEKELAAVRLELKETSRKLEQE
LENRKQLEVMLINVRSEYDNLQNAERKTKSEHAIDMDRQSYNNQDLALRELRIKYDVLTS
HCDEAQENLKSVQAQLDAERAQSTQQSQLLLSTKERNDALQIKLDYLREKYTKLSDENQT
LTEKKHNLEKEYSITELELKNLRDKYEQEVQNYQNSLNSSQIGNEQCKSESTFVSELEKK
LRDEETLRHSLQQQLNDVERQRKVLSLDCDHFSDQIQQLGMEGNFHSEARMFTVGIFFQR
TTKSLYKNQTKELKELVSTRDEELNTVKSNLTRQVEAVQLQLEMDHKARRLAEDSLSDRE
KEKAMLEIELKRLSNRHKQEITSKDAIIDQAIDKLTEVMQKKSTQNKKGYRADELKRKDK
EFKKLQQDVQQVCVLFLLTVSACLLGYVCDFVFCFAFHQEKRKYDEMVAMYQKEMSDLQA
TLYEEGQAKERLLIELECKEEELELLQQKLHMLLSETCSVDSASLAEVVDFNNGNFTMYD
MSLMRMCDLPKKKKYHVFFKLFMLAKGRAVLPDVMSHKGHDFIAISFHSPTSCDICSKQL
WNVLKPPPALECKRCHVKIHKDHLEKHDRDVAPCRVNYDPMLARDLLLMVSSADECKVWV
NRIRKCMENFRKGGDFLKTARSSGSSVHNIFTCVMDSDRMTREKYWMQRCGKKIYKFYTI
LVDGDKLIWRKISIRCVSSSGELVENVNEISILQ
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatgcgagctagtcattttacattaatcaaagtaattggtcgcggtgcatttggt
gagatcaagcgtgcggactcagcatttttctgggaagagcgagatattatggcgtacgct
gatccaatgtggattgttaaacttcattacgcgttccaagatttgaagtatctttacatg
gtaatggaatacatgcctggtggagatttggtcaatttgatggctaattatgacgttccg
gagaaatgggcaaagttttacacagccgaggtggttttgggattggacgcgatacactcg
atgggttacatacacagagacgttaagcccgacaacatgttgatcagtgcttctggacat
gtaaaattggctgattttggtacgtgcgtgaaaatggattcagacgggttggtgcgttgt
agcaccgctgtcggtacaccagattacattagtccagaagttttgcgctctcaaggtagt
gaaggtgtttacggtagagaatgtgattggtggtccgttggtgtattcatttacgaaatg
ttagtcggtgaaacaccgttttatgccacttcgttggtggccacgtattcgaagatcatg
aaccaccaaagtactttgacttttccggacgacgtttcaatttcggatgctgcgaaagat
attatttgcaagtttttgtcgaatcgaaatgtacgtcttggacgacagggtgtagctgag
atcaaatcccatacgttttttgtcaacgacgagtgggattggaatactatacagaacagt
aatgttggaaaaattttctgcatgctctcaccattgcgtttggatgattggtttaaattt
ttagcaagaccaccggtagtacccgatttgaccggtgacgatgatacgagaaattttgat
aacatcgaaaaggagggtcttcctcaagaaagttttcaacttccaagagcatttgcaggc
aatcagttgccgtttattggtttcacatattcaagagaatttagtccaatggcatgtttg
gcggtgtctcagcaaacgttggccgacgccaagtcggatttgcagcgactcagcatgcaa
aatgaacaatatgccagtgaactgggcttggttcaagaaactaaaaaattagccgatgct
tgtttgcagcaggtcaatgcagacagcagttcgatcgaatttgactgtttgaaattggaa
aaagaactggctgctgttcgtcttgaactcaaagagacatcgagaaagttggaacaagaa
ttggaaaatcgcaaacaactggaagtaatgcttattaatgtacgaagtgagtatgacaat
ttgcagaatgcggaaaggaaaaccaaatccgaacatgcgattgatatggaccgtcaatcg
tacaataatcaagatctggctttgcgagaattgcgcatcaaatatgatgtattgactagt
cattgtgatgaggcgcaagaaaatttgaaatcagtccaagctcaattggacgctgaacgc
gctcaatctacccaacaatcgcagctattgttgtccactaaagaacgtaacgatgcgttg
caaatcaagctggattatttgagagaaaaatataccaaattgtccgatgagaatcaaact
ttgacagaaaagaaacacaatttggaaaaggaatattcgataacagaattggagttgaaa
aatttgcgtgataaatatgaacaagaggtgcaaaattatcaaaattcgttgaacagttct
cagattggcaacgaacagtgcaaatccgaatcgacgtttgtaagcgaattggaaaagaaa
ttgcgtgatgaagagacgttgcgacattctttgcaacagcagttgaacgatgtggaacgc
cagcgtaaagtgttgtcgttggactgtgaccatttcagtgatcaaattcagcagttgggc
atggagggaaatttccattctgaagcaagaatgttcacagttggaatttttttccaacga
actacgaaatcattgtacaagaatcagacgaaagaactgaaagaattggtttcaaccaga
gacgaagaactgaatactgtgaaatcaaatttgactcgacaagtggaagctgtacaattg
caattggaaatggatcataaagctcgtcgtttggctgaagattcgttgtctgatcgtgaa
aaggagaaagcgatgctggagattgaactgaaacgtttgtccaaccgtcataagcaggaa
attactagcaaagatgcgattattgatcaggctatagataaattgactgaggtgatgcag
aagaagagcacgcagaacaaaaagggatacagagcagacgagcttaagcgaaaagacaaa
gaattcaaaaaactgcaacaggatgtgcagcaagtatgtgtattatttttattgaccgtg
agcgcgtgcttactgggatatgtatgtgattttgtattttgctttgcttttcatcaggag
aaacgaaaatacgacgaaatggtggccatgtatcagaaagagatgagtgatttgcaggcg
actttgtacgaagagggacaagctaaagaacgactgctgattgaattggaatgcaaagag
gaggagttggaattgctccagcagaagctgcacatgcttctcagtgaaacttgcagtgtc
gattcggctagtctggccgaggtggtcgatttcaacaatggaaattttaccatgtacgac
atgtcactaatgcggatgtgcgatttgccgaagaaaaagaaataccacgtatttttcaaa
ttatttatgctggcgaaggggagagccgtcttgccggacgtgatgtcacacaaggggcat
gattttatagcgatttcatttcacagcccaacatcctgtgacatttgtagcaaacaactg
tggaacgtgctcaagccacctccggctttagagtgcaagagatgtcatgtgaaaattcac
aaagatcatttggaaaagcatgaccgagacgtggctccatgccgtgtgaattacgatccg
atgttggctcgcgatctgcttttgatggtgtcatccgccgacgagtgcaaagtttgggtg
aatagaattcgaaaatgtatggaaaattttcgaaaaggcggtgactttttgaaaactgcc
agatcgtctggttccagtgtccacaacattttcacctgtgtaatggacagtgatcgaatg
acacgggaaaagtattggatgcaaagatgtggaaagaaaatttacaaattttatactata
ttagttgacggagacaagctgatatggagaaaaatatccatccgctgtgtatcatcatct
ggtgagctagttgaaaacgtaaatgaaatttccattttgcaatag

DBGET integrated database retrieval system