KEGG   Trichinella spiralis: Tsp_10227Help
Entry
Tsp_10227         CDS       T01609                                 

Definition
(RefSeq) ChOline/Carnitine o-acyltransferase superfamily
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
tsp  Trichinella spiralis
Pathway
tsp00071  Fatty acid degradation
tsp01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Tsp_10227
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tsp03029]
    Tsp_10227
Enzymes [BR:tsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     Tsp_10227
Mitochondrial biogenesis [BR:tsp03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    Tsp_10227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 10900968
NCBI-ProteinID: XP_003372467
Position
Unknown
AA seq 673 aa AA seqDB search
MVKVSFTSLLFCSVVYSSLCWLAIVQIVRLTIKLMFMYRGWMYERLRNTRMATKFYLLIV
KLILKHEPMLKSFQGALPRLPLPTLRDTLRRHLDTLKPLLNDESRQRMERLSNEFENTIG
PKLQRYLTLKSWLSGNYVSDWWEEYVYLRGRSALMINSNFYGLDSLGHAGTTIQAARAAN
ITYASLLFRRLIERQELKPILIGVVPLCSSQYERTFNTCRIPGVEIDTLKHWNDARHIAV
YCHGAWFKVLIHDGRRLLKPCELQINCYDVTDDERHLGALTAIDRTSWAEIRQKYFSFGV
NRSSLHAIESSAFTLCFDEEEYFYDPNDISKLDHWAHMNLHGKGYDRWFDKSFNLIVSKN
GKVGINAEHSWYEFLADAPIMSHYFEYATVFDILKLGYTAEGNCIGDVDITPVSARRLKW
DFTPELSREIADSVQKAEALINDVEMALIVFREFGKGFIKKCQISPDGFIQMILQLTYFR
DQRKFCLTYEASMTRLYREGRTETVRPVTFESCAFVRAMCDDTCSIEQRRDLLYKACEKH
QKAYLDAMCGKGVDRHLFCLYIVSRYLQLDSPFLKEVLSEPWRLSTSQTPQQQTDLVDTR
KYPDYVSAGGGFGPVADDGYGISYIIGGENIISFHISSKRYCETTSSTRFRETLLQSLRD
VRTINYSCDFAKK
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagtttctttcacatcactgctgttttgttcagttgtctatagtagcttgtgt
tggttggctattgtgcaaattgtacgtttgactatcaaattgatgttcatgtaccgtgga
tggatgtatgaacgtctgagaaacaccagaatggcgacgaaattttatctgttgattgta
aagttgatcctgaaacacgaaccaatgttgaaaagttttcaaggtgctttgcctcgtttg
cctcttccgacattgcgggacactttgcgtaggcacttggatacattgaagccgttgctg
aatgacgaaagtagacaacgcatggaacgtttgtctaatgaatttgaaaatactattggt
ccaaaattgcaacgctatttgacattaaaatcctggctttcgggaaattatgtttctgac
tggtgggaagagtacgtctatctccggggacgttccgctttgatgataaattctaatttt
tatggattggattcattaggccatgcaggtacaactattcaggcggcaagagccgctaat
attacttatgcttcattattgttccgtcgcttaatcgaacgtcaagaattgaaacctatt
ttaattggtgttgtaccgctttgttcctcgcagtacgaaagaacattcaacacttgccgc
atacctggtgttgaaattgacaccttgaagcattggaatgatgctcgacatattgccgtc
tattgtcatggtgcatggtttaaagttcttattcacgatggccgacgcttgttaaaacct
tgtgaattgcaaatcaactgctatgacgtcaccgatgacgaacgacatttgggtgctttg
acagcaatagatcggactagctgggctgaaattaggcaaaaatatttctctttcggtgtt
aacagaagttctctgcatgctattgaatcatcggcgtttaccttgtgctttgatgaagaa
gaatatttctatgatccgaatgacatttcaaaacttgatcactgggcacacatgaatttg
catgggaaaggttatgatcgttggtttgataaatccttcaatttgatcgtatcgaaaaat
gggaaagttggaatcaatgctgaacattcgtggtatgaatttttggcggatgctcccatt
atgtcacattattttgaatatgcgacagtttttgatatattgaaacttggatacactgcc
gaaggcaattgcataggtgatgtggacatcacacctgtgtccgcacgacgtttaaagtgg
gattttactcccgagctaagtcgagaaattgctgacagcgttcagaaggcggaagcgtta
attaatgacgtggaaatggcgcttatcgttttccgggaatttggaaaaggttttattaaa
aaatgtcaaatatctccggatggtttcatccaaatgattcttcagttgacttatttcagg
gaccagagaaaattctgcctgacgtacgaagcttcgatgactcgcttatatcgtgaagga
cgcacagaaaccgttcggccagtgacgtttgaatcttgcgcttttgttcgtgctatgtgt
gacgatacgtgttctattgaacagagacgtgatttgctatacaaagcttgtgagaaacat
cagaaagcttacttggatgcaatgtgcggaaagggagttgatcgtcatttgttttgtttg
tatatcgtcagtcgttatttgcagttggattcgccatttttgaaagaagttctttctgag
ccgtggcgtttgtcgaccagtcagacccctcaacagcagactgatttggttgacacgaga
aaatatccagattatgtttctgccggtggtggcttcgggcctgtagccgatgacggatac
ggcatatcttacattatcggtggtgagaacataatcagctttcacatttcgtctaaacga
tactgtgaaacaacgagttccactcgttttcgagaaacactgttgcagagcttgagagat
gtacgaaccatcaactattcttgtgactttgcgaaaaaataa

DBGET integrated database retrieval system