KEGG   Trichinella spiralis: Tsp_11392Help
Entry
Tsp_11392         CDS       T01609                                 

Definition
(RefSeq) tropomyosin
  KO
K10373  tropomyosin 1
Organism
tsp  Trichinella spiralis
Brite
Cytoskeleton proteins [BR:tsp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     Tsp_11392
Exosome [BR:tsp04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   Tsp_11392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II CENP-F_leu_zip DUF745 Fez1 CLZ Vps5 ATG16 Lebercilin Golgin_A5 DUF724 DUF4472 FPP DUF1664 Exonuc_VII_L BicD ERM TPR_MLP1_2 DUF16 HrpB7 EzrA Reo_sigmaC HemX Spc7
Motif
Other DBs
NCBI-GeneID: 10901153
NCBI-ProteinID: XP_003372651
UniProt: E5SUX9
Position
Unknown
AA seq 284 aa AA seqDB search
MDAIKKKMQAMKIEKDNAMDRADAAEEKARQQQERVEKLEEELRDTQKKMMQVENELDKA
QEELTGANAQLEEKEKKVQEAEAEVAALNRRIQLLEEDFERAEERLKIATEKLEEASQTA
DESERVRKVMENRSLQDEERVYQLEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAE
ERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRLLTQRLKEAETRAE
FAERSVQKLQKEVDRLEDELVHEKEKYKAISEELDQTFQELSGY
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaattaagaagaagatgcaagcgatgaagatcgagaaggataacgcgatggat
cgcgcagatgcggcagaggaaaaagcccgtcaacagcaggaacgcgtagaaaagcttgaa
gaagaactgcgtgatacacagaagaagatgatgcaagttgaaaacgagctcgacaaggcc
caagaagaactcaccggagccaatgctcaattggaagagaaagaaaagaaagtccaagaa
gcggaagctgaggttgcagcattgaaccgacgaattcagcttcttgaagaagatttcgaa
agagctgaagaacggctgaaaattgccactgaaaaactggaagaagcttcacagacagct
gatgaaagcgaaagagtacgcaaagttatggaaaatcgctcattgcaagatgaagaacgc
gtttatcagctagaagcgcagctcaaagaagctcagctgttagctgaagaagccgaccga
aaatatgacgaagtagctcgtaaacttgcaatggttgaagctgacttggaaagagctgaa
gaacgcgcagaagccggtgaaaacaaaattgtggaattggaagaggagctgcgtgttgtt
ggtaacaacttgaaatctttggaagttagcgaagagaaagctctgcaacgcgaagactca
tacgaagaacaaattcgattgttgactcaacgattgaaggaggctgagactcgagctgaa
tttgctgaacgttcagtgcagaaattgcaaaaggaagttgaccgattggaagacgagctg
gttcatgagaaagaaaaatacaaagcaatttctgaagaattggaccagactttccaagaa
ttatccggctactga

DBGET integrated database retrieval system