KEGG   Trichinella spiralis: Tsp_13732Help
Entry
Tsp_13732         CDS       T01609                                 

Definition
(RefSeq) vacuolar protein sorting-associated protein 41
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
tsp  Trichinella spiralis
Brite
KEGG Orthology (KO) [BR:tsp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tsp04131]
    Tsp_13732
Membrane trafficking [BR:tsp04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    Tsp_13732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40_like WD40
Motif
Other DBs
NCBI-GeneID: 10907575
NCBI-ProteinID: XP_003370861
Position
Unknown
AA seq 286 aa AA seqDB search
MTGTVDSQSTESEVEDSAEEPRFKYKRLLNDLVELFKADAASCIAVHERYIVLGTQWGKI
VVLDHDGNIIADKCFAAHSVAVNQISIDRTGEHLASCSNDGKAVIYGLFSQEQSRCVALD
RPVRSIAIDPNFARTGSGQQFVTGDRVLILHERSIFARNKQQLLFVGKERDGYIHRISWQ
DSMIAFANETGVLVFDNRAKVLITQVLRRHELTWRCELLPAHIQWFDSSSFMIAWANTLT
ICAIRDSSVVSSEFPNKLVEVRFMWEFPDHFISGVSYTPCLLPHSQ
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaacagtggacagtcagtcaactgaatctgaagtggaagattcggccgaagaa
ccgagattcaagtacaagcgtttgttgaatgatttggtcgaattgttcaaagccgacgcg
gctagctgcatcgccgtgcacgaacgttacatcgttctcggtacccagtggggtaaaatt
gtcgtactcgaccacgacggcaacatcatcgccgacaaatgttttgccgcgcattcggtg
gctgtcaatcagatcagcatcgatcgtaccggtgagcatttggcaagctgttccaacgac
ggcaaagctgtcatttatggacttttctcgcaagaacaaagccgttgtgtagcactggac
cggccggtacgttccatagcaatagatccgaattttgcccgcaccggttccggccaacag
ttcgtcaccggcgacagggttctaattttgcacgagcgttcaatatttgctcgtaacaag
caacaactgctcttcgttggcaaagaacgcgatggatatatacaccgcatctcatggcaa
gattcgatgattgcgtttgcaaatgaaactggtgttttggtttttgataatcgtgctaaa
gttctgatcactcaagtacttcgtcgtcacgaattaacttggcgctgcgaacttcttcct
gctcacattcaatggttcgacagcagcagtttcatgatcgcttgggcgaatacgttgaca
atttgtgcaattcgtgacagcagcgttgtttcgagcgaatttcccaacaagctagtcgaa
gtacgcttcatgtgggaatttccggatcattttatttccggtgtttcatataccccatgt
ttgttgccacattctcag

DBGET integrated database retrieval system