KEGG   Thamnophis sirtalis: 106537709Help
Entry
106537709         CDS       T06107                                 

Gene name
ACAT2
Definition
(RefSeq) acetyl-CoA acetyltransferase, cytosolic
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00071  Fatty acid degradation
tsr00072  Synthesis and degradation of ketone bodies
tsr00280  Valine, leucine and isoleucine degradation
tsr00310  Lysine degradation
tsr00380  Tryptophan metabolism
tsr00620  Pyruvate metabolism
tsr00630  Glyoxylate and dicarboxylate metabolism
tsr00640  Propanoate metabolism
tsr00650  Butanoate metabolism
tsr00900  Terpenoid backbone biosynthesis
tsr01100  Metabolic pathways
tsr01200  Carbon metabolism
tsr01212  Fatty acid metabolism
Module
tsr_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    106537709 (ACAT2)
   00630 Glyoxylate and dicarboxylate metabolism
    106537709 (ACAT2)
   00640 Propanoate metabolism
    106537709 (ACAT2)
   00650 Butanoate metabolism
    106537709 (ACAT2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106537709 (ACAT2)
   00072 Synthesis and degradation of ketone bodies
    106537709 (ACAT2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    106537709 (ACAT2)
   00310 Lysine degradation
    106537709 (ACAT2)
   00380 Tryptophan metabolism
    106537709 (ACAT2)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    106537709 (ACAT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tsr04147]
    106537709 (ACAT2)
Enzymes [BR:tsr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     106537709 (ACAT2)
Exosome [BR:tsr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106537709 (ACAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C DUF5417
Motif
Other DBs
NCBI-GeneID: 106537709
NCBI-ProteinID: XP_013907379
Position
Unknown
AA seq 396 aa AA seqDB search
MDRGDEAVVFVAAARTPVGSFNGALSTLHAHELASVVIKELLERTKIDPKEVSEVILGQV
LTAGAGQNPARQASVGAGIPYEIPAWSCQMICGSGLKAIWLGAQSIMTGDSSIVVAGGME
NMSKAPHVIHLRNGVKMGEASLQDTIIVDGLTDAFYCYHMGITAENVAKQWKVTRKEQDQ
QAVMSQNKAENAQKGGYFDKEIVPVVVPSRRGPTEVKADEHPRHGCNLETVAKLKPCFIT
DGTGTVTAANASGINDGAAAVILMKKSEAIKRNLIPLARIVSSAQVGIDPSVMGIAPITA
IRKAVEKAGWTLDQVDLYEINEAFAALGVAITKELKLKPEKVNIEGGAVALGHALGASGC
RILVTLLHSLERTGGKRGVAALCIGGGMGIAMCIER
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcggggacgaggccgtcgttttcgttgctgctgcaaggacccctgtcggatcc
ttcaatggtgccttgtcaaccctgcatgcccatgaattggcttcagtagtcattaaagaa
ttgttggagaggacaaaaattgatcctaaagaagtatctgaagttatacttggacaagta
ttgactgcaggtgctggccagaatcctgctcgacaagccagtgttggggcagggattcca
tatgagataccagcttggagttgtcaaatgatatgcggatcaggcctgaaagccatatgg
ctcggggctcagtctattatgacaggagattccagtattgtggtggctggtggtatggaa
aacatgagcaaggctcctcatgtcattcatttgcgtaatggggtgaagatgggggaagcc
tctttgcaagacactattatcgtagatggcttgacagatgccttctactgttatcacatg
ggtattacagctgaaaatgtggccaaacagtggaaggttactcgaaaagaacaagaccaa
caggctgtaatgtcacagaacaaggctgaaaatgcccagaagggtggatattttgataaa
gagattgtacctgtggttgtcccttctagaagaggccccacggaagtgaaagctgatgaa
catcctcgtcatgggtgcaacctagaaacagtggcaaagttgaaaccttgcttcataacc
gatgggacaggcaccgtgactgcagcaaatgcctcaggtataaatgatggtgccgctgct
gttattcttatgaaaaaatcagaagcaattaaacgaaatctcattcctttggcacggatc
gtgtcttcggctcaagttggtattgatccttcagttatgggaatagcacccatcacagca
ataagaaaagctgtggaaaaagctggttggacattggatcaagtggatctatatgaaatt
aatgaagcttttgctgcattaggtgttgcaataacaaaagaactaaaactcaagccagaa
aaggtaaacattgaaggtggggctgttgctcttggccacgcccttggagcatctggttgt
cgaatcctagttacacttctgcactcactagaacgaacaggtggaaaacgaggagttgca
gctttatgtataggaggaggaatgggcatagctatgtgtatagaaagataa

DBGET integrated database retrieval system