KEGG   Thamnophis sirtalis: 106539344Help
Entry
106539344         CDS       T06107                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04010  MAPK signaling pathway
tsr04060  Cytokine-cytokine receptor interaction
tsr04068  FoxO signaling pathway
tsr04110  Cell cycle
tsr04218  Cellular senescence
tsr04350  TGF-beta signaling pathway
tsr04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106539344
   04350 TGF-beta signaling pathway
    106539344
   04068 FoxO signaling pathway
    106539344
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106539344
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106539344
   04218 Cellular senescence
    106539344
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106539344
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tsr04052]
    106539344
   00536 Glycosaminoglycan binding proteins [BR:tsr00536]
    106539344
Cytokines and growth factors [BR:tsr04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   106539344
Glycosaminoglycan binding proteins [BR:tsr00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   106539344
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-GeneID: 106539344
NCBI-ProteinID: XP_013909604
Position
Unknown
AA seq 223 aa AA seqDB search
MSFFSVLLMASWILGPHMTDCAFSMCQNLDLEAARARRIEAIRGQILSKLQLETPPKEEG
VPHPLPPEVMLLYNSTWEPVRRVATCEGRRMARREDEEYYAKEVRRVEMLTSGHADNSIP
GPFSTPFFRFLHFGVSAAHPNFSHLIQAELRIYKVPNPGSHATEQHVELSQVLPLYSKVN
PEGSAAPCCVPRKLEPLTILYYVGRKAKVQQLSNMIVKSCRCR
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcttctccgtcctgctgatggcctcatggatccttggcccgcacatgactgat
tgcgcattttccatgtgccagaatttggatcttgaggcggctcgggccagaaggattgag
gcgatccggggccagattcttagcaagctgcagctggagacaccccccaaggaagaaggg
gtgccccaccctttgccccccgaggtgatgctcctctacaacagcacgtgggagccggtg
aggcgggtagccacctgcgagggaagacgcatggctcggcgcgaagacgaggaatattac
gccaaagaagtccggcgggtggaaatgttgacctccggacacgctgacaattccatcccc
ggccctttctccacccccttcttccgattcctgcactttggggtctccgctgcgcacccc
aacttcagccacctgatccaagctgagctgaggatctacaaggtcccgaatcctggatcc
cacgccactgagcagcatgtggagctctctcaggtgcttcccctgtatagtaaagtgaac
cccgaagggtcggctgctccttgttgtgttccccgcaaactggaacctttgaccatcctg
tattacgtcggacgcaaggctaaagtccagcagctgagcaacatgattgtgaaatcctgc
cgttgccgttaa

DBGET integrated database retrieval system