KEGG   Thamnophis sirtalis: 106539454Help
Entry
106539454         CDS       T06107                                 

Gene name
CACNA1I
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04010  MAPK signaling pathway
tsr04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106539454 (CACNA1I)
   04020 Calcium signaling pathway
    106539454 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tsr04040]
    106539454 (CACNA1I)
Ion channels [BR:tsr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106539454 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel DUF3043
Motif
Other DBs
NCBI-GeneID: 106539454
NCBI-ProteinID: XP_013909725
Position
Unknown
AA seq 2002 aa AA seqDB search
MCSLEHVDLGMNEPPTSLEQPPPSPDLEDNEDDADVPALDPNVPYPDLAPVVFFCLKQTT
SPRSWCIKMVCNPWFECLSMMVILLNCVTLGMYQPCDDMDCLSNRCKILQVFDDFIFIFF
AMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTVRVLRPL
KAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCFMDENLT
IQGNITLPPYYQPEEDDEMPFICSLSGDNGIMGCQEIPPLKERGHVCCLDKDDYFYYTSV
RQEFNVSGMCVNWNQYYNECRTGNANPHKGAINFDNIGYAWIVIFQVITLEGWVEIMYYV
MDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHQLMQEQRARYLSSSTVA
SYMEPGDCYEEIFQYVCHIVRKAKRRTLGFYNSLQDRRLGPTEPGTAKQRVNGKERKQYS
RCRKHSSIDYMPQGLGQPTTKTLVSEASNCPKCYKTQQEATQRLSVLDSVNSDPEDGEKV
CDQEGDGGKGVMESNTDLEKEEDDGEERGQLMLCNDMWQEVRVKLRGIVDSKYFNRGIMI
AILVNTISMGIEHHEQPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYNIFD
SIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVATFCML
LMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLY
NGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEVFAFIFPMQGDANRSYSDED
QSSSNIEEFDKFQDSSDPKLCAIPMTPNGHLDPSLPCLNQPGASAGMMNPSLNTLPSDIL
MALESRKNSVMSLSSSRSSHHHGTRYHSGGWGSRRSSWNNLTRGHSLKHKPFSAEHESLL
SGERHTITEAEGERPVIHHHRRTFSLDTKDSSELELAPAVSSGHKPSWKIGVTLGSNKHQ
DCNGKMPTIAKDIFPEMNNRKDHGEDDEEIDYSLCFRIKKMIEAYKPDWCELREDWSIYL
FSPENKFRILCQTIIAHKLFDYIVLAFIFLNCVTIALERPEIEQRSTERIFLTVSNYIFT
AIFVAEMTLKVVSLGLYFGEQAYLRSSWNILDGFLVFVSIIDIVVSVASAGGAKILGVLR
VLRLLRTLRPLRVISRAPGLKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKF
YHCLGVDIRNITNRSDCMAANYKWVHQKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDA
VAVDQQPVTNNNPWMLLYFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEK
RLRRLEKKRRSKELPKWFFCLFVGNLGLLFMLLFFIYAALGVELFGKLVCNDEHPCEGMS
RHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDDRSCLSNLQFISPLYFVSFVLT
AQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELEMAHGLCPHSMSSLNPGQDGGGGR
KESEGHLCMTCYSPAQENLWLDSVSLIIKDSFDGELMIIDNLSGSVFHHYSSPAMCEKCN
HDKQEIQLAEMEALSLNSDKSSILLGDDGDSSNVDQPSPKEKDGEDSPNSTRNTGLEECL
FPLTNTGPSLPPENYQYEMEKIPFSQAQSWLNNETNEVETEFFLPAVSAKLSSQEKASCP
ENLPKISLQASWASLQSPNVNSSLIHQTTESDTSLDDGRSNSSEGSLQTTLEDSLNLSDS
PQCALDLPVVLCPVPAATQKALVVPLSPASRRQSIRGRGIFTLQNIRRHQRSHSSGGSTS
PGCTYHDSMDPSDEEGIGSSLRGGGNSSEQSETLSSFSLTSLFSPPPPSQALALVKKCNS
TSSLHANSSSRSSASNEAKQFYSVDPRGFLSMPSWVTDFCKNSPSPREGGVPEGLDKIGT
PDHSPPVPSELQLGTRVSKRHR
NT seq 6009 nt NT seq  +upstreamnt  +downstreamnt
atgtgctccctggagcatgtggatctgggaatgaatgagccaccaacttcattggagcag
ccaccgccatccccagacctagaggacaatgaggatgatgctgatgtaccggcactggac
ccaaatgtaccctatcctgacttggccccggtggttttcttctgcctaaaacagacgacc
agccctcgtagctggtgcatcaagatggtgtgcaatccctggtttgaatgtctcagcatg
atggtaatcctactaaactgtgtcacacttggaatgtatcaaccctgtgatgatatggat
tgcctctccaacagatgtaaaattttgcaagtgtttgatgacttcatttttatcttcttt
gctatggaaatggtgctgaagatggtggccctggggatatttggcaagaaatgctacctt
ggagatacctggaaccgcctagatttcttcattgttatggctgggatggtggaatattcc
ctggatcttcaaaatattaacttgtctgcaattcgcactgtacgagttctgaggcccctt
aaagccattaaccgagtgcctagcatgcgaatattggtgaatttgctcttggacacatta
cccatgctggggaatgttctccttctctgcttctttgtcttcttcatctttggcatcatc
ggtgtacagctgtgggctggtctactgaggaatcgctgtttcatggatgagaacttgaca
atccaaggtaacatcactcttcctccctattatcaacctgaggaggatgatgaaatgccc
ttcatctgttcactgtcaggcgataatggtatcatgggctgtcaagagatacccccactc
aaagaacggggccacgtgtgctgcttggacaaggacgactacttctactatacctcggtc
aggcaggagttcaacgtcagtggcatgtgtgttaactggaaccagtattacaatgagtgt
cgtacaggcaatgccaatccacacaaaggggcaatcaactttgataatattggctatgcg
tggattgttatattccaggtgatcactctggaaggatgggtggagattatgtattatgtg
atggatgctcattcattctacaacttcatttacttcattttgctgatcattgtggggtcc
ttttttatgattaacctgtgcctagtagtcattgccacccaattttccgagaccaagcaa
cgagaacaccaactgatgcaggagcagcgagcacggtacctgtcctccagcactgtggcc
agctatatggaaccaggagattgttatgaagagatcttccaatatgtctgccacattgtt
cgtaaagctaagcgtcgcacccttggcttctacaacagcctgcaggatcgtcgtctcggt
ccaaccgaaccaggcactgccaaacagagagtgaatggaaaagaacggaaacaatactca
cgttgccggaaacattcttctattgattacatgcctcaaggacttggtcagcctactacc
aagacactggtctcggaagccagcaactgccccaaatgttacaagacccagcaggaagca
acccaaagactttctgtgcttgatagtgtcaattcagatccggaagatggagaaaaagtc
tgtgaccaagagggagatggcgggaaaggagtcatggagtctaacacggatttggaaaaa
gaagaggatgatggagaagagagaggacagctcatgctttgcaatgatatgtggcaagaa
gtaagagtcaaattgaggggaattgtggatagcaaatacttcaaccgtggaataatgatt
gcaatcctcgtaaataccatcagcatgggcattgagcatcatgaacagccagaggagctg
acaaatattttggaaatttgcaatgttgtgtttaccagcatgtttgccctggagatgatt
ttgaaacttgccgcctttggtctctttgattaccttcgcaacccatacaacatttttgac
agtatcattgtcatcatcagcatctgggagattgtaggtcaggctgatggtggcctctca
gtgctgaggacattccggctactgagggtgctgaaactggtgagattcatgcctgcgttg
cggcgccaacttgtggtactgatgaagacaatggataatgtagcaaccttctgcatgctc
ctcatgctctttatctttatcttcagcatccttggaatgcacatctttggttgtaaattt
agtcttagaactgacacaggagacacagtccctgaccggaaaaactttgactccttactt
tgggccattgtcactgtattccagatcttgacacaggaggattggaatgttgtactttat
aatggcatggcctcaacctccccatgggcatcactttattttgtggctctcatgaccttt
ggaaactatgttctcttcaacctactggtggcgatcctagtggagggattccaggcagag
gtctttgcatttattttcccaatgcagggtgatgctaaccgctcatattccgatgaggac
cagagttcatcaaatattgaagaatttgacaagttccaggatagttcagatccaaagctt
tgtgcaattcccatgactccaaatggacatcttgaccccagtcttccttgtctaaaccag
cctggggcaagtgctggaatgatgaatccatccctcaatactctgccgtcagatatcctc
atggcccttgaatctcggaaaaacagtgtgatgtctttatctagctcccgtagctctcat
caccacgggactcggtaccatagcggaggctggggaagcagacgttccagttggaacaac
cttactcgaggacatagcctcaaacacaagcctttttcagctgaacatgaatcacttcta
tctggggagcggcacacgataacagaggcagaaggagaaaggccagtaattcaccatcat
cgacgtacattttcattggataccaaagattcctctgaattggaattggctccagcagtc
tcatccgggcacaagccatcatggaagataggagtgactctagggtcaaacaagcaccag
gactgcaatggtaaaatgcccacaatcgctaaggatatctttccagaaatgaacaatcgg
aaagaccatggagaagatgatgaagagatagattatagcctgtgtttccgtataaagaag
atgatagaggcctacaagccagattggtgtgagttgcgggaagattggtccatctattta
ttctcaccagaaaacaaatttcgcattctctgccaaactatcattgctcacaagctattt
gattatatcgtcctggccttcattttcttgaactgtgttactattgccttggagagacct
gagattgaacagaggagcacagagagaatcttcctcacggtgtccaattacatcttcaca
gcaatctttgttgctgagatgacactgaaggtagtctctcttggtctgtattttggagaa
caggcctacctacgcagtagttggaatatcttggatggctttttggtgtttgtatccatt
attgatatcgtagtttcggtagcctctgctggaggagccaaaatcctaggagtgctaaga
gtcctccgacttctgcgcactttacgccccctgagggtcatcagccgtgctccaggtttg
aagctggtggttgaaactctcatttcatcactcaagcctattggaaatattgtcctcatc
tgctgtgctttctttatcatctttggaattcttggagtgcagcttttcaaaggaaaattc
taccattgcctgggtgttgatatccgaaatatcacaaataggtctgactgcatggctgcc
aattacaaatgggtccatcaaaaatacaactttgacaatctgggccaggctttgatgtca
ctctttgttctggcttccaaagatggctgggttaatattatgtacaatggattggatgct
gtggctgtggatcaacagccagtgaccaacaacaacccttggatgctactttacttcatt
tctttcttactcatcgtcagcttcttcgtgctcaacatgtttgtaggggtggtggtggag
aatttccacaagtgtcggcaacaccaagaagctgaagaggcccggaggcgggaagaaaag
cgtttgaggcgcctggagaagaagcgtaggagtaaggaattacctaagtggtttttttgt
ctgtttgttggtaatcttggacttctcttcatgctcctttttttcatctacgctgctcta
ggagtggagctttttggcaaacttgtatgcaatgatgagcacccatgtgaaggaatgagc
cgccatgccacctttgagaattttggaatggccttcctcacccttttccaggtttccact
ggtgacaactggaatggcattatgaaggatacactacgtgactgcactcatgatgatcgg
agctgcctgagcaacctacagttcatctctccactctactttgttagcttcgtgctcaca
gcccaatttgtcctcatcaatgttgtagtagctgtccttatgaagcacctagatgacagc
aacaaggaagcacaggaggatgcagaaatggatgctgagattgagcttgagatggcacat
ggattgtgccctcatagcatgagctcattgaatcctggacaagatggaggaggtgggaga
aaggagtctgaaggacatctatgcatgacatgttactctccagcacaggagaacttatgg
ctggacagtgtgtctttaataattaaagactccttcgacggggagttaatgatcatcgat
aacctatcgggctccgtcttccatcattactcctcgccggccatgtgcgagaagtgtaac
catgacaagcaagagatccagctggctgaaatggaggccttatcgctcaattctgataag
tcttctatcctgctaggagatgatggagatagttccaacgttgaccagccaagtcctaag
gaaaaggatggtgaagacagtcctaattctacaaggaatacaggcttggaagaatgtctc
ttccctttaacaaatacaggaccttctctgcctccagaaaactaccagtacgaaatggaa
aaaatccctttcagtcaagctcagtcttggctaaataatgagaccaatgaagttgaaaca
gagttttttctccctgctgtttctgctaaactgtcaagtcaggagaaagcatcttgtcca
gagaaccttcctaaaatctctctgcaagcttcctgggcctcactgcaatctccaaatgta
aactcctcacttattcaccagaccacagagagtgacacttcccttgatgatggcaggagc
aatagttcagaaggcagcttgcagaccacactggaagacagtttaaaccttagtgactca
ccccagtgcgccctagacctcccggtagtattatgcccagtgccagcagccacccaaaaa
gctttggtggtcccactttcccctgcctcccgaaggcaaagcataaggggccgtggcatc
tttactctccagaacatcaggaggcaccagcggagccacagcagtggaggaagcactagt
ccgggttgtacttatcatgattccatggacccttctgatgaagaagggattgggagcagc
ctaaggggaggaggcaacagcagtgagcagtcagagaccctcagcagtttctctctgact
tctctcttttcaccacctcctccatctcaagctctggcacttgtgaagaagtgcaacagc
accagcagtctccatgccaactcttcttcacggagttctgcatcaaacgaagccaagcag
ttctactcagttgacccaaggggttttttatccatgccatcttgggtgacagacttctgc
aagaacagcccttctccgagagagggtggtgtaccagagggcttggacaaaattgggact
ccagaccacagccccccggttccttctgagttgcaactggggaccagagtcagcaagaga
catagatga

DBGET integrated database retrieval system