KEGG   Thamnophis sirtalis: 106539796Help
Entry
106539796         CDS       T06107                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00230  Purine metabolism
tsr01100  Metabolic pathways
tsr04270  Vascular smooth muscle contraction
tsr04540  Gap junction
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106539796
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106539796
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106539796
Enzymes [BR:tsr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     106539796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Motif
Other DBs
NCBI-GeneID: 106539796
NCBI-ProteinID: XP_013910162
Position
Unknown
AA seq 775 aa AA seqDB search
MYGFINTCLKSLVVEKYGEEIWENLRIQTGVQDTFFTFEVYKDEITMQLIDTACQMLDVS
PDMVLKQFGEYFFEFCKQSGYDHMLRTLGGNLYEFIENLDALHSYLSLSYQKMNAPSFRV
EKNEDGSMYLHYYSDRRGLCHIVPGIIGAAALDFFNTEISMEIVNQTEEEERTGKKEHIV
FLVTQKPVFSYKRRNKFSSSHFLPNSGSQAERRLNKEELERTMNKIRDKTSAKRSHWETI
RGIVTIGKGRLLKGFDPVYPRTLWIDPKTFCIGLPFHIIFDEHLRVKQAGVSIQKIVPGL
QILGIRLNQYFTIVRPEVKFTISSVQRFINSQFVFRTKREMMPDSWKQRPMLELRGQMIW
MESVQCMLYLCSPLLRTLHELEERHMHISDIAPHDVTRDLILLNQQRLAEMELSNQLERK
KEELRILSKHLEEERKKTEALLYAMLPKHVANQLKEGKRVEAGEFKECTILFSDVVTFTN
ICAQCEPIQIVLMLNTMYLRFDRLTTVHDVYKVETIGDAYMVVGGVPVPVSTHAERVANF
ALGMIIAAKDIKNPVSENPIQIRVGIHTGSVLAGVVGEKMPRYCLFGDTVNIASRMESHG
VPNKIHLSGSVYQCLKENNFDIKERGEIDVKGKGKMHTYFLVQNTIATENEIMGRPREDA
GLNHETSQLSQDCTADGMQNSFSQDVPLNSDKELPPIVPMKYADRPIENHTNVKGRHESR
AKDLTDKLLDAETYASLHGDQQPNQNPYNFIQRRHRPAAETPQIRNNRSNFCNLF
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgtatggatttataaacacatgcctgaagtctctggtggttgaaaaatatggtgaagaa
atatgggaaaatttaagaatccaaactggagtacaggatactttttttacttttgaagtt
tataaagatgaaatcacaatgcaactaattgacacggcatgccaaatgttagatgtttcc
ccagatatggttctgaaacaatttggagaatatttctttgaattctgtaaacagtcaggt
tatgaccatatgctgagaacgctgggaggaaatctgtatgaatttatagaaaacctggat
gcattacacagttacctcagtctgtcttaccagaagatgaacgctccttcctttagggta
gaaaagaatgaagatgggtcaatgtatttacattattattcagacagaagaggcttatgc
cacatagttccaggaatcattggtgcagcagctttggactttttcaatactgaaatttca
atggaaattgtcaatcagacagaagaagaagaaagaacaggaaaaaaagaacacattgta
tttcttgtaacacaaaaacctgtattttcctacaaaagaagaaacaagttctcttcctca
catttccttccaaattctgggtctcaggcagaaagaagactgaataaagaggaacttgaa
agaaccatgaataagatcagagataaaacaagtgccaaaaggagccactgggaaacaatc
agaggaattgtgacaataggaaaaggtcgacttcttaaaggatttgatcctgtctatcct
agaactctctggattgacccaaagacattttgcattgggcttcctttccatattattttt
gatgaacatctcagagtgaagcaagctggggttagcattcaaaagattgtacctggcctt
caaatattgggcattcgtctcaatcagtacttcactattgtacgccctgaagtgaaattt
accatctccagtgttcagagatttatcaacagccaatttgttttccggaccaagagagaa
atgatgccggactcttggaagcagcgtcctatgttagaactaagagggcagatgatctgg
atggagtctgttcagtgcatgctgtacctttgttcccctctgctgcgtacattgcatgag
ttggaggaaagacacatgcacatttcggacatagctccccatgatgtcactagagatttg
atcttgctcaaccaacagcggttggctgagatggagctctccaatcaactggagaggaaa
aaagaggagctgcggatcctgtctaaacacctggaggaagaaaggaagaaaacagaagcc
ctcctgtatgccatgctgcctaaacatgttgccaaccagctcaaagaggggaaacgagtt
gaggcaggagaattcaaagaatgtactatattattcagtgatgttgtgacttttaccaac
atttgcgcccagtgtgagcctattcagatagtgctcatgttaaatacaatgtatctacga
tttgacaggttaaccacagtacatgatgtctacaaggttgaaaccataggcgatgcctac
atggttgtagggggtgtccctgtccctgtatcaacccacgctgaacgggttgccaacttt
gcccttggaatgatcatagcagccaaagacattaaaaaccctgtttctgaaaatcctatt
caaattagggttgggatccacacagggtctgtccttgcaggggttgttggagaaaaaatg
ccacgttactgtttgtttggagatacagtgaatatagcatcccggatggaaagtcatgga
gtgccaaacaaaatccacctcagtggcagtgtttatcaatgcctcaaagaaaataatttt
gatattaaggaaagaggagaaattgatgtaaagggcaaaggaaaaatgcacacttatttt
ctggtccaaaatacaattgcaactgagaatgagatcatgggaagaccaagagaagatgct
ggcctcaaccacgaaacttctcaattgtctcaagattgcacggctgatggcatgcaaaac
tctttctcacaagatgtcccactgaattcagacaaggaattgcctcctatcgtaccaatg
aaatacgcagatagacccatagaaaaccacaccaatgttaaaggaaggcatgaatcaaga
gcaaaggatttaacagacaaactgcttgatgcagagacctatgcaagtctccatggtgac
cagcagccaaaccaaaatccatacaatttcatacaaagaagacacaggccagctgcagag
acaccacagatcaggaataacagatctaatttttgtaacctgttttaa

DBGET integrated database retrieval system