KEGG   Thamnophis sirtalis: 106540727Help
Entry
106540727         CDS       T06107                                 

Definition
(RefSeq) cytosolic phospholipase A2 gamma-like
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00564  Glycerophospholipid metabolism
tsr00565  Ether lipid metabolism
tsr00590  Arachidonic acid metabolism
tsr00591  Linoleic acid metabolism
tsr00592  alpha-Linolenic acid metabolism
tsr01100  Metabolic pathways
tsr04010  MAPK signaling pathway
tsr04217  Necroptosis
tsr04270  Vascular smooth muscle contraction
tsr04370  VEGF signaling pathway
tsr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106540727
   00565 Ether lipid metabolism
    106540727
   00590 Arachidonic acid metabolism
    106540727
   00591 Linoleic acid metabolism
    106540727
   00592 alpha-Linolenic acid metabolism
    106540727
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106540727
   04370 VEGF signaling pathway
    106540727
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106540727
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106540727
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106540727
Enzymes [BR:tsr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     106540727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B
Motif
Other DBs
NCBI-GeneID: 106540727
NCBI-ProteinID: XP_013911432
Position
Unknown
AA seq 577 aa AA seqDB search
MQCRFQTDEVYLRLGLANVSYTLVTREETMQVNADPGASQISEESAKVDLAFICDIRISR
DISNHEKQHVEARKRIVQKCLQKFHIECPKDNFPTVAVLGSGGGLRALIALQGTLRELQE
HNMLDTVMYLCGVSGSTWCMSYIYENEEWGKQLKSLEDKLCERLVDPHQDWKKILKILKN
LIEPSKDDTYSLTDFWGYFVAYIILNELDDDHHLSDEQTICKNGIVPYPIYAAVDATKLD
DANRFHSDIWFEFTPHESGFFNPGAFVDVTYLGSKFNNGKLKEKKNEKKMTYLREYRCSC
DCCKVALAIIKFFLYTMESQTCMMENKTHADVKKHIINITEILENKGPSDTYNFCCTLKE
IDYSLDLTENGKHILKLVETLQLEFTDIWDIVTFMHKSLACILTWKWGNISNYTYKYIDL
KDKNLTDKTNIQLADAGLVINSAYPLILRPERKVEFILSFDFSEGDPFETIKEASQYCKE
NKLPFPEIDARNLDKDKDNPEDCYIFRSNGCPTVMHFPLFNKVNCEGHVSDWRNRYTTFN
KTSYPKQDIQNLLEAAKINVRNNAEKIRQTLKSVANP
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgcaggttccagacagatgaggtgtatttgagacttggtctagcaaatgtttca
tatactctggttaccagagaagaaactatgcaagtaaatgctgatcctggagcaagccag
atttcagaggaatctgctaaagtagatttagcttttatatgtgacatcaggatttcaaga
gatatatcaaatcatgaaaaacagcatgtagaggcaagaaaacgcatagtgcaaaaatgt
cttcagaagtttcacattgaatgtcccaaggacaatttccccactgttgctgtactgggt
tcaggtgggggactgagggctttaattgcactgcagggaaccctgagagagctgcaggaa
cataatatgctggatacagtgatgtatctttgtggagtatcaggttcaacatggtgtatg
tcatacatttatgaaaatgaagaatggggaaaacaactaaagagtttggaagataagttg
tgtgaaagactggtagatccacaccaggactggaagaaaatattaaaaatattaaaaaac
ctgattgagccaagtaaagatgacacatactccttgactgatttctggggttattttgta
gcttacataatactgaatgaactggatgatgatcatcatctgtctgatgaacagacaatt
tgtaagaatgggatagttccttacccaatctatgcagcagtggatgcaaccaaattagat
gatgcaaatcgattccactcagatatctggtttgaatttacaccacatgagagtggattc
tttaaccctggagcatttgtcgatgtgacttatttgggaagcaagttcaacaatggcaaa
ctgaaggaaaagaagaatgaaaagaaaatgacttatctgagagaatacagatgctcctgt
gactgctgtaaagttgctttagcgataataaagttcttcctatatactatggaaagccaa
acatgtatgatggaaaataaaacacatgcagatgttaagaagcatatcataaacattaca
gaaatcctagaaaacaaaggccccagtgatacctacaacttttgttgtaccctgaaggaa
attgattattctttagacctcactgaaaatggaaaacacattttgaaactggtggagacc
ttacagttagaatttacagatatatgggacatcgttacatttatgcacaaatctcttgct
tgcatccttacatggaaatggggaaacatttctaactatacttacaaatacattgacctg
aaagacaaaaacctgactgataaaacaaatattcagttggcagatgctggcttagtcata
aattctgcttacccgcttatcttgcgtccagaaagaaaagtggaattcattctgtctttt
gattttagtgaaggagatccttttgaaactatcaaggaagcaagtcaatactgtaaggaa
aacaagcttccctttcctgaaattgatgcccgtaatttagacaaggataaagacaaccct
gaagactgttacatcttcagaagcaatggttgtccaactgtcatgcactttccacttttc
aacaaagtgaactgtgaaggtcacgtatcggactggcgtaataggtatacaaccttcaac
aagacatcttacccaaagcaagacatccaaaatcttcttgaagcagcaaaaataaatgtg
cgaaataatgctgaaaaaatccggcaaacattgaaatctgtagcaaatccttaa

DBGET integrated database retrieval system