KEGG   Thamnophis sirtalis: 106544310
Entry
106544310         CDS       T06107                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    106544310 (RDH5)
Enzymes [BR:tsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     106544310 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 KR
Other DBs
NCBI-GeneID: 106544310
NCBI-ProteinID: XP_013916027
UniProt: A0A6I9XPS2
Position
Unknown
AA seq 319 aa
MWCYILLISVVWAVVWFFRDQKILSNFKDKYVFITGCDTGFGNMLAKKLDKKGFHVLAGC
LTQKGADNLDRTSSSNLRTTLIDVTSSESISKAVEWVKAEVGRKGLFGLVNNAGLGSSIG
PTEWMTVEDYRKVMSVNTFGMIEVSLAFLPLLKRARGRVVNVSSVLGRISANGGGYCVSK
YTVEAFSDSLRRDMYHFGVKVSIVEPGFFKTAMTNLETIEAALTHYWDRMTPETQQSYGE
GFFRNYLKVQKFIMNIICDSDLSKVTNCMEHALQAKHPRSRYSAGWDAKFLWLPISYLPS
FLVDISLAIILPKPAQRMH
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtggtgctacattctactcatcagtgtggtttgggctgtagtctggttcttccgcgac
cagaagattttgagcaacttcaaagacaaatatgttttcatcacgggttgtgacacgggt
tttgggaacatgctagccaagaagcttgacaaaaagggtttccacgtgctggcaggctgt
ttgactcagaaaggagccgataacttggaccgcaccagctcgtcgaacctgcgcaccaca
ctgattgacgtcaccagctccgaaagcatctccaaagcagtggaatgggtgaaagctgaa
gtgggtcgaaaaggtctctttggtctggtgaacaatgcaggtttaggcagctctattggc
cccacggaatggatgaccgtggaagactaccgcaaagtcatgtctgttaacacttttgga
atgatcgaggtatcgttggccttcctgccattgctcaagcgagcgcgtggacgagtagtc
aatgtttccagcgtcttggggcggatttcagccaacggtggtggctactgcgtttccaaa
tacacagtggaggccttctctgacagcctcaggagggacatgtatcattttggggtaaaa
gtctccattgtagagccaggctttttcaaaacagccatgactaatcttgaaacgatagag
gccgctctgacgcactactgggaccgaatgactccggaaacccagcagagctatggtgaa
ggtttctttcgcaattacttgaaagtccaaaagttcatcatgaacatcatctgcgattct
gatctcagcaaagtgacaaactgcatggagcacgcccttcaagctaagcacccccgctct
cgttacagtgcaggatgggatgctaagtttctgtggctgccaatctcttatctaccttcc
tttttggtggatatttccctggctatcatcttaccaaagccagctcagcggatgcactaa

DBGET integrated database retrieval system