KEGG   Thamnophis sirtalis: 106544340Help
Entry
106544340         CDS       T06107                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00600  Sphingolipid metabolism
tsr01100  Metabolic pathways
tsr04020  Calcium signaling pathway
tsr04370  VEGF signaling pathway
tsr04371  Apelin signaling pathway
Module
tsr_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    106544340 (SPHK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    106544340 (SPHK1)
   04371 Apelin signaling pathway
    106544340 (SPHK1)
   04020 Calcium signaling pathway
    106544340 (SPHK1)
Enzymes [BR:tsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     106544340 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat Tim54
Motif
Other DBs
NCBI-GeneID: 106544340
NCBI-ProteinID: XP_013916059
Position
Unknown
AA seq 535 aa AA seqDB search
MEGDSGQGASEEVLLSGVFRLVPSSKANCALSLTSGAELLVRRLDSAGRSSNAGSALSLS
TCVGCYAFQGKSASQQPAAAYFSVVCYPFKKGWWYRGESRQKVAKTFCVLASQDAEENRH
VAETWVRTIRELSAPHLEGGIHGLLPQKCQVMVLLNPRSGAGEALHLFTSQVQPMLTEAS
IGFHKFVTEKHNHAWDLAREEDMSKWDAVVIMAGDGLLHEVINGLMERPDWKTAIQKPLC
ILPGGSGNALAASLNHYASRSHVAKEELLKNCTYFLCKGLHAPMDLVSLRMASGKRLFSF
LSFGWGFVSDVDITSERYRKLGSARFTVGTFQLLTSLQVYKGRLSYLPAEIQSSASSSLP
PTGMNACPSPQHPPHQVSTANGKSPVNILPQPASSLLKEDSVLEDSLLVPFEQPVPKHWT
VVPEEEFVSIVGIQQSHLGTDFIIAPTAKLFDDAIHLFYVTAGISRMGMLKLFMAVEKGN
QLALNSPHVHYVPVKAFRLEPLEPKGFMTVDGEVLTCEPVQGQIHNRLARIIGGS
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggaaggagactcgggccaaggcgcttccgaggaagttttgctctcgggcgtctttcgc
ctcgtcccttcttcgaaggcgaactgtgccctgagcctcacgagcggcgcggagctgctg
gtgcgccggctggactcggctggacggagcagcaacgcgggcagcgcgctcagcctctcc
acttgcgtgggctgctacgctttccagggcaagagcgcctcgcagcagccggcggccgcc
tacttctccgtcgtttgctatcctttcaagaagggctggtggtaccgcggggaatctcgg
caaaaggtggcgaagaccttttgcgtcctcgcgtcgcaggacgccgaagagaaccggcac
gttgccgagacctgggtgaggacgatccgagagctctcggccccccatctggaaggagga
atacatggcttacttcctcagaagtgccaggtgatggtgctgctgaacccgcgaagtgga
gcaggagaggccctacatctcttcacctctcaagttcagccgatgttgacagaagccagc
ataggattccataagtttgtcactgagaaacataatcatgcttgggatttggcaagggag
gaggatatgtccaaatgggacgctgtggtcattatggctggagacggcttgcttcatgag
gtgatcaatggcctgatggagcgtcctgactggaagaccgcgatccagaagcctctctgc
attctcccaggaggctctgggaacgctttagctgcttcacttaatcactatgccagcaga
agccatgtggcaaaggaggaactgttgaagaattgcacttacttcttatgcaaaggcctg
catgctcccatggacctggtctccctccgcatggcctcaggcaagcggctcttctccttc
cttagctttggctggggttttgtctctgatgtggatattaccagcgagaggtaccgcaaa
ttgggtagtgcccgttttacagtgggcacgttccaactcctcacttcactccaggtttac
aagggccgcctctcctacctgccagctgaaatacaaagctctgcctcaagttccttgcct
cctacagggatgaatgcctgcccctcacctcagcatccacctcaccaggtctccactgcg
aacgggaaatctcctgtcaacatcctccctcagcctgcctcttccctcctgaaggaggat
tctgtgctggaagactccttgttggtgccctttgagcagccagttcccaagcactggact
gttgtccccgaggaggaatttgtttctatagttggcattcagcaatcccacctgggaaca
gactttattatagctcccacagccaagctgtttgatgatgccatccacctcttctatgta
actgctggcatttcccggatgggaatgctcaagttattcatggccgtggagaaagggaat
cagttggctcttaacagccctcatgtccactacgtgcccgtgaaagcctttcggctggag
cccctagagcccaagggctttatgaccgtagacggcgaggtgttgacatgtgagccagtg
caaggacaaatacacaaccggctagcccgtattattggtggctcctga

DBGET integrated database retrieval system