KEGG   Thamnophis sirtalis: 106545987Help
Entry
106545987         CDS       T06107                                 

Gene name
SLC4A1
Definition
(RefSeq) band 3 anion transport protein isoform X1
  KO
K06573  solute carrier family 4 (anion exchanger), member 1
Organism
tsr  Thamnophis sirtalis
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tsr02000]
    106545987 (SLC4A1)
   04147 Exosome [BR:tsr04147]
    106545987 (SLC4A1)
   04090 CD molecules [BR:tsr04090]
    106545987 (SLC4A1)
Transporters [BR:tsr02000]
 Solute carrier family (SLC)
  SLC4: Bicarbonate transporter
   106545987 (SLC4A1)
Exosome [BR:tsr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106545987 (SLC4A1)
CD molecules [BR:tsr04090]
 Proteins
  106545987 (SLC4A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto DUF4729 PTS_EIIA_2
Motif
Other DBs
NCBI-GeneID: 106545987
NCBI-ProteinID: XP_013918193
Position
Unknown
AA seq 914 aa AA seqDB search
MERVSMGKAGSYQRHMDTSSSSSSEEEPRGTEPAKPLISHKASHNSYVELHELVMDKNNE
FRWMEASHWIKLEEDFEEMGHWGRPHLSYLTFQSLLEVRKAFSKGTVLLDLQERSLAGIA
NQVLSQMIYEGKLKPDDQEVLLRTLLLQHSHPSESASLNTLLPALVQRTDTKDSTQPLLQ
EHQQIEMKTFSNGSEQGESSHSDFKKQLLDKIPPDAEATLGLVGCATFLDRPTVAFVRLK
EAVELDSVLEVPVPVRFLFVVLGPDSPHISYHEIGRAISTMMSERVFRNDSYLAEGRQDL
IKSLDEFLDCCIVLPPSEIQNERLLKMLLPVQKDFLRKRYLPVEKKLEEPLKDLGHKLKD
HDITAEDSDDSLRRTGKIFGGMVKDIKRRYPKYLSDIKDALNPQCLAAVIFIYFAALSPA
ITFGGLLAEKTERLIGVSELLLSTAVQSGLFCLLGAQPLLVVGFSGPLLVFEEAFYAFCV
NKNYEYLVGRVWIGFWLILIVVVVVAFEGSFLVRFISRYTQEIFSILISLIFILETFFKL
IKIFKEHPLKEVYKNITYPPDEEPRYPVPNTALLSLVLMGGTFFIAFFLRKFKNSSFFPG
KLRRVIGDFGVPIAIFIMTLADYLIKDTYTQKLKVPKGLQVSNPEQRNWFIHPLGSSLGN
PFPIWMMFATALPALLVFILIFLETQITTLIVSKPERKMLKGSGFHLDLLLIVGMGGIAP
LLGMPWLSATTVRTVTHANALTVMSKTTLPGEKACIQEVKEQRVTGFLVAILVGLSILME
PILKLIPLAVLFGIFLYMGVTSLNGIQLYDRILLLLKPPKYHPDVSYVTKVKTWRMHIFT
FTQMLCLGLLWGVKSSPASLALPFILILTVPLRLFLLPFIFTDVELKCLDADDAEVTFDE
TEGQDVYDEVQMPV
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggagagggtatccatgggaaaagcaggatcctatcaaaggcatatggacacaagtagc
tcctcctcatctgaggaggagccaagaggtacggagcctgcgaagccactcatctcccac
aaagcttcccataattcatatgtggaacttcatgagctggtcatggacaagaacaatgag
tttcgctggatggaggcttctcactggatcaaactggaagaggactttgaggagatgggg
cattgggggagacctcacctttcatacctgactttccaaagccttttggaggtgcgcaag
gcttttagcaaaggaactgtccttctggatttgcaagaaagaagtctagctgggattgct
aatcaggtgctttcccaaatgatctatgaagggaaactcaagcctgatgaccaagaagtg
cttttaagaactcttctacttcagcacagtcaccctagtgaatcagcttcattaaacact
ctcttgcctgcactggtacaacggacagataccaaagattcaactcaaccactgcttcaa
gaacatcaacaaattgagatgaagaccttttctaatggctcagagcagggagagtcaagt
catagtgattttaagaaacagctgttagataagattcctcctgatgcagaagccactctg
ggattggttggctgtgccaccttcctggaccgacccactgtggcctttgtacgcttgaag
gaggctgtggagctggactctgtcctggaggttcctgtgcctgtcaggttcctttttgtg
gttctgggtcctgattccccccacattagctaccatgaaatcggaagagccatctcaact
atgatgtctgagagggtatttcgcaatgactcctatttggcagaaggaagacaggacttg
ataaagagtctggatgagttcctagattgttgcattgtcctcccaccctctgagatccaa
aatgaaagacttctcaaaatgttgctgccagtgcagaaggatttcctaaggaagaggtac
ctcccagtggagaagaaactggaagagccactaaaagacctagggcacaaactgaaagac
catgacatcacagcagaagattcagatgattccttgcgccgaactggaaagatttttggg
gggatggtgaaagacataaaacgtcggtaccccaagtatctcagtgacatcaaggatgct
ctgaatccacaatgcctggctgcagtcatcttcatctactttgcagccctttctcctgcc
attacttttggaggcctgcttgctgaaaagacagaacgtctgataggagtttctgagctt
ctactctctactgcagttcagagtggactcttttgcttgctgggagctcagcctctcctt
gttgtgggattctccggcccccttttggtctttgaagaagctttttatgcattttgtgtg
aataaaaactatgaataccttgtgggaagagtctggattggcttttggctgatactgata
gtggtagtggtggtggcttttgagggcagcttcctggtgcgtttcatctctcgctacact
caggagatcttctcaatcctcatctccctcatcttcatcctggaaactttcttcaaactc
atcaagatttttaaagagcaccctctgaaagaggtgtataaaaacatcacctatccccca
gatgaagaaccaaggtaccctgtaccaaatactgctttgctttctcttgtgctgatggga
ggaacatttttcatcgctttcttcttacggaagttcaaaaacagcagttttttccctggc
aagcttcgccgggtgattggtgactttggtgtccctattgccatctttatcatgacgttg
gcagactatcttattaaagatacctacactcagaaattgaaagttcccaaaggccttcaa
gtctccaatcctgaacaacggaattggtttatccatccattaggttcttcattaggaaat
ccattccccatatggatgatgtttgctacagctttgccagctctcctagttttcattctc
atcttcttggagacacagatcaccacgctgattgtaagcaaacctgagaggaagatgctg
aagggttcaggtttccatctcgacctccttcttattgttggaatgggaggtatcgcacca
cttttgggcatgccctggctgagtgccaccacagtgaggactgtcactcatgctaatgct
ctgacagttatgtccaagactactctgccaggagaaaaggcctgcatccaggaggtcaag
gaacagagggttactggcttcctggtggctattcttgtgggcttgtccatactcatggaa
cccatcttgaagctgattccacttgcagtactctttggcatctttctttatatgggggta
acatctctcaatggcattcaactatatgaccgcatacttcttttgctgaagccacctaaa
taccatccagatgtgtcctatgttacaaaagtaaagacctggcgtatgcacatcttcacc
ttcacccagatgctctgcctaggattgctgtggggagtgaaatccagcccagcctccctt
gccttgccttttatactcattctgactgtccctcttcgactcttcctgctccctttcatt
ttcacagatgttgagctcaagtgtttggatgctgatgatgctgaggtgacttttgatgag
acagaaggccaagatgtctatgatgaagtccagatgcctgtttga

DBGET integrated database retrieval system