KEGG   Thamnophis sirtalis: 106546144Help
Entry
106546144         CDS       T06107                                 

Gene name
GPX8
Definition
(RefSeq) probable glutathione peroxidase 8
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00480  Glutathione metabolism
tsr00590  Arachidonic acid metabolism
tsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106546144 (GPX8)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106546144 (GPX8)
Enzymes [BR:tsr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     106546144 (GPX8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 106546144
NCBI-ProteinID: XP_013918406
Position
Unknown
AA seq 212 aa AA seqDB search
MEPSLPLATLTLKSSKLKNKVFIIFISMVLCTALLALLQLKFLKPRKKDFYSFEVEDWKG
RTMSLERFRGKAALVVNVASYCPHTEKNYIMLQELQREFGSSHFTVLAFPCNQFGQMEPG
LNDEIIYFAKSNYGVTFPIFSKIKVLGSEASPAFKFLIDTSKTEPKWNFWKYLISPEGKV
LKYLKPEEPIENIKQDIAALIREIIIKKREDL
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggagccgtctctgcccctagcaacgcttacgctaaaaagctcaaagctgaaaaacaag
gttttcattattttcatttctatggtgttatgcacagccttgctggccctgctgcagctc
aagttcttaaaacccagaaaaaaagacttttattcctttgaagtggaggattggaaagga
agaaccatgtccttggagagattccgaggcaaagcagccctggttgtaaacgtggctagt
tactgtccgcacacagaaaaaaattacatcatgctgcaggaactccagcgagagtttgga
tcatcccatttcactgtgctggcctttccttgcaatcagtttgggcaaatggagccaggt
ctgaacgacgagatcatttattttgctaaatcgaattatggagtgacattccccatcttc
agtaaaataaaagtcctaggttctgaagcatcgccagcttttaaatttctaatagatact
tctaaaacggaacctaagtggaatttctggaaatatctcatcagccctgaaggtaaagtc
ttgaaatacctgaagcctgaagaacccatagaaaacatcaagcaggatatagccgctctg
attagggagatcattataaaaaagagggaagacctttga

DBGET integrated database retrieval system