KEGG   Thamnophis sirtalis: 106547141Help
Entry
106547141         CDS       T06107                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
tsr  Thamnophis sirtalis
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tsr04131]
    106547141
Membrane trafficking [BR:tsr04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    106547141
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 NEL
Motif
Other DBs
NCBI-GeneID: 106547141
NCBI-ProteinID: XP_013919674
Position
Unknown
AA seq 883 aa AA seqDB search
MGRAAFEAIAVMVNQIHKSLESSQDQHGHNHLLASYIFYVFRLPVMEPESGVPPHSGALQ
YATLSRATGRPVSLNLSHSKSISNSNPDLTTTPTSPDEEVQKIIGSKGIDRSHSWVNSAY
APGGPKSVFRRNHPNSSTDLKQAAECAPNRISSYLEGSTFVPAAPMRPATKKLLHEELIL
QWVVSTSSVREAALHQSWFFFQLMVCSDCQSLASETLDSLHLCFFPLLLQINNWLLTTQN
PNALIALRMDLIRIVCSHEHYVTLNLPCSGLSPPASPSPSVSSATSQSSAFSSHTQDQRV
ANMFELSTAFRQQHFLAGLVLMELALILEPDAEGAFFLHKKAICTLHNLLCSHDSDSRYR
DPAVRAQVAQLYLPLIGIIMDALPQLYDFTENHLQRGRLASVMVEDGDGDGSTISQSVAM
AIAGSPLPHTHRSTVFQMPSVPLRQHSMLSAEASRNLLVCLLWVLKNADGALLHRWLADL
SAFHVNRLLDLLYLCVSCFEYKGKKAFERINSLTFKKSLDMKARLEEAILGTIGARQEMV
RRSRAERGPFANQENVRWRKNIAHWRQNSDKVDKCVCGHFWHICTLFPEMLFEEDTELCA
DLCLRLLRHCSSRVAIIRTHASTSLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQTF
NEEHLRRSLKTILTYAEEDPELRETTFAEQVLCRTVSETKESVLGGVLRVLLHSMGCTPS
AAFLEHCFATQRALVSKSKNISSNVLEESAVSDDILSPDEEGICSGKYFTEQGLVGLLEQ
AASSFTLGGLYEAVNETYKILIPIHEASRDFRKLAVLHGKLQDAFSKITSQRMFGTYFRV
GFFGSKFGDLDEQEFVYKEPSITKLAEISHRLEVRAKISSNEI
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtgcggcgtttgaagccattgctgtgatggtgaatcagatccacaagagcctg
gagagcagccaagatcagcatggccacaaccatctgttggcctcttacatcttctacgtt
ttccgtctgcctgtgatggagccagagtccggagtgccaccacacagtggtgccctccaa
tatgctaccttgtcccgggcaactgggcgccctgtcagccttaacctctcccattccaaa
agtatcagcaacagcaatcctgacttgaccaccacaccaacttcccccgatgaagaggtt
cagaagattatcggcagcaaggggatcgaccgctctcactcttgggtcaactctgcctat
gcccccggaggccccaagtccgtgtttcgcaggaaccatccgaactccagcacggacctg
aagcaggctgcagagtgtgcacctaatcgtatctcctcctatctcgagggctccactttt
gtgccggcagctccgatgagaccagccaccaaaaagctacttcatgaagaactgatcctc
cagtgggtggtgagcaccagttctgtgcgggaagctgctttgcatcaatcctggttcttc
ttccagctgatggtatgttcagactgccagtctttagcgtcagaaacattggattctctt
cacttgtgtttttttcccctacttctccagatcaataactggctattgaccacacaaaac
cccaatgccctcattgcgctcaggatggacttgatccgtatcgtctgcagccatgaacat
tatgtcaccctaaatcttccctgcagtggcctctcccctcctgcttccccttctccctcc
gtctcatcagcaacgtcccagagttcagcattctccagccacacacaggaccagcgcgtg
gccaacatgtttgagctctctacagcttttcgccaacagcacttcctggcaggcttggtg
ttgatggagctggcactcatcctggaacctgatgcggagggggccttcttcctccacaag
aaagccatctgcactctgcacaacctgctgtgcagccacgactctgattcccgctacagg
gaccctgcggtgcgagcccaagtggctcagctctatttgcccctgattggcatcatcatg
gatgccctaccgcagctctatgacttcacagagaaccatctccagagagggcgtcttgct
tctgtgatggttgaggatggagatggagatggcagcaccattagccagtcagttgccatg
gccattgcgggctctcctttgccccatacccatcggtctacggtcttccaaatgccatca
gtgcctctccgccagcacagcatgttgtctgctgaggcaagtcgcaacctgctggtgtgt
cttctgtgggtactgaagaatgcggatggggctctgctgcatcgctggctggctgacctc
tcggctttccatgtgaaccgtctccttgacttactctacctctgcgtctcctgctttgag
tacaagggcaaaaaggcctttgaacgcatcaatagcctgaccttcaagaaatctctggac
atgaaggcgcgactggaggaagccatcttgggcactattggggcacgtcaagaaatggtt
cgacgcagccgagcagagcgtggtccctttgcaaaccaagaaaatgttcgctggaggaag
aatattgcccactggagacagaattcggacaaggtggacaagtgcgtttgtgggcatttc
tggcatatctgcacattgtttcccgaaatgctttttgaagaagacaccgaactgtgtgct
gatctgtgcctgcgtctcctgcgccactgtagtagccgagtagccatcattcgcacccat
gccagcacctccctctaccttctcatgaggcagaacttcgagattggcaacaactttgcc
cgggtgaagatgcaagtcaccatgtctctctcctcgcttgtgggaacatctcaaaccttc
aatgaggagcacttgaggcgctcactgaagaccatcctcacctacgctgaagaagaccca
gagttgcgagagacaacctttgctgagcaggtattgtgcagaacagtgtctgaaaccaag
gagagcgtcctgggtggggtgctgagggtgctcctccacagcatgggctgtacacctagt
gctgccttcttggaacactgctttgccactcagagagcactagtgagcaagtccaagaac
atatcttccaacgtgctagaagagtccgctgtttcagatgacatattgtccccagatgaa
gagggcatctgctctggaaaatacttcacagaacaaggactggtgggcttgctggagcaa
gcagcttcttcctttactttgggtggactttatgaggctgtcaatgaaacctataagatc
ctcattcccatccacgaagccagccgggacttcaggaagttggcagttctgcatggcaaa
ctgcaagatgcttttagcaagataactagccagagaatgtttgggacgtatttccgggtt
ggtttttttggcagcaaatttggagacttggatgaacaagagtttgtctacaaagaacct
tctattactaaattagccgaaatttctcatcgacttgaggtaagagctaagatatcctca
aatgagatatag

DBGET integrated database retrieval system