KEGG   Thamnophis sirtalis: 106549171Help
Entry
106549171         CDS       T06107                                 

Gene name
PCBD1
Definition
(RefSeq) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00790  Folate biosynthesis
tsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    106549171 (PCBD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tsr04147]
    106549171 (PCBD1)
Enzymes [BR:tsr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     106549171 (PCBD1)
Exosome [BR:tsr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106549171 (PCBD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-GeneID: 106549171
NCBI-ProteinID: XP_013922222
Position
Unknown
AA seq 103 aa AA seqDB search
AGKAHRLSGEEREQLLPNLRAVGWNEVEGRDAIYKEFHFKDFNRAFGFMTRVALQAEKLD
HHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVANTLA
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
gcaggaaaagctcaccgactgagcggagaagaaagagaacagctcctgccaaatctcaga
gcagtaggatggaatgaggtggaaggcagagatgctatctacaaggagttccatttcaag
gattttaatcgggcttttggatttatgaccagagtagctctacaagcagaaaaactggat
catcatcctgaatggtttaatgtttacaacaaagttcacataaccttaagtacacacgag
tgtgctggtttatctgaacgggacatcaacttggccagtttcatagagcaagttgcaaac
acactagcctaa

DBGET integrated database retrieval system