KEGG   Thamnophis sirtalis: 106549385
Entry
106549385         CDS       T06107                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00230  Purine metabolism
tsr01100  Metabolic pathways
tsr04020  Calcium signaling pathway
tsr04114  Oocyte meiosis
tsr04261  Adrenergic signaling in cardiomyocytes
tsr04270  Vascular smooth muscle contraction
tsr04371  Apelin signaling pathway
tsr04540  Gap junction
tsr04912  GnRH signaling pathway
tsr04914  Progesterone-mediated oocyte maturation
tsr04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106549385 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106549385 (ADCY4)
   04020 Calcium signaling pathway
    106549385 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106549385 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106549385 (ADCY4)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106549385 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    106549385 (ADCY4)
   04916 Melanogenesis
    106549385 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106549385 (ADCY4)
   04270 Vascular smooth muscle contraction
    106549385 (ADCY4)
Enzymes [BR:tsr01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     106549385 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 CD52 HNOBA
Other DBs
NCBI-GeneID: 106549385
NCBI-ProteinID: XP_013922496
Position
Unknown
AA seq 975 aa
MPCQRRPRAASDTPREDLFYQTYYCLSQQYPLILLLLVIVLSICVALIATTFSSDKDFSS
NLAFLITLFIALLIFSLILVFVCMENIFQRCTRLFSAVIWTCLITMGYIFIFVGGVVCAW
DQVSFFLFIIFIVYTMLPVGMKDAIVAGVVASLSHIIVLSIYLSMGHSSPSQLAVQQLAN
LVIFVCGNLVGAYHKYLMEVALGETFHETFNLIQSRVKLESEKRHQEHLLLSILPAYIAL
EMKAEIIERLRDGDQPQGPHESANNFHNLYVKRHQNVSILYADIVGFTLLASECSPKELV
LMLNELFGKFDQIAKDNECMRIKILGDCYYCVSGLPVSLPNHARNCVKMGLDMCRSIKKL
RDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSDDVTLANHMEAGGVPGRVHITEATL
SHLGGMYTVEEVCCVRDTYLRENRIKTFLVVDPKAEEESSHDLLSPAPGESLTMRASVRM
TRYLESWGAAKPFANFKPLDNLPAEATGFVRNNHSDISLGSLTMERCRAPRSPDEDLEGV
DEKFFQLIEQLNSQKQWKKSEDFNCITLYFKQESLEKEYRLSPLPSFNYYTACSFLVFVS
NFLIQILVVYKTEALGISYGISFFLFLLLLLTCFSGHLAKCFLKGPKIFYWVPSILANVC
TQPWLRVSLGIITILVVLTMSVLNLFFMPETSCFVKLENSTLSSMNTVQEFSRFNSLFSV
PYYIYCCVLGFLSCSLFLHMNFELKLTMLILCLVVYNVLFLHTHSWLSDCYVSQLYHNQT
ALRPGVLKEPKVMGAFSFFIFFFTLLGLARQNEYYCRLDFLWKKKFKKEREEIETMENLN
RVLLENVLPADVAQQFIRQNRRNTDLYHQSYDCVCVLFASIPDFKEFYSESNVNHEGLEC
LRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAATGLNVAAGQDSQQVMSSFRMTLLI
LNLSTGMRFHALFPH
NT seq 2928 nt   +upstreamnt  +downstreamnt
atgccctgccagcgtcgtccacgggcagccagcgacacgccccgagaagacctcttctat
caaacctattattgcttgagccaacagtaccctctgattcttcttctcttggttatcgtg
ctgagcatctgtgtggctctcattgctaccaccttttccagcgacaaggatttctcctcc
aacttggctttcctgattacgttgttcatcgctctgctcatcttcagcctgatcttggtc
tttgtgtgcatggaaaacatcttccagagatgcacccgcctcttctcagctgtcatttgg
acttgtctgatcacaatgggttacatattcatctttgtcggtggagtggtgtgtgcttgg
gaccaggtctccttcttcctcttcataatcttcattgtttacaccatgttgcctgttggc
atgaaagacgccatagttgccggtgtagtagcttctctctcgcacatcatagttctgagt
atctacctctcaatgggccacagctcaccttcacaactggctgtgcagcaacttgccaat
ctagtcatctttgtctgtggtaacttggtgggtgcctaccacaagtatttgatggaagtg
gccctgggtgagaccttccatgagaccttcaacctcatccaatctcgagttaagctggag
tcggagaagcgacaccaggaacatttgctcctctccatcctccctgcttacattgccttg
gaaatgaaggctgagatcattgagagactccgggatggagaccagccccagggtccgcat
gaaagtgccaacaacttccacaatctttatgtcaagaggcaccagaatgtcagcatcctc
tatgcagatattgttggcttcacacttctggccagtgaatgttctcccaaagagctggtg
ttgatgctcaatgaactctttggcaagtttgatcagattgccaaggataatgaatgcatg
aggatcaagatcttaggggattgctactattgtgtgtctggattgcctgtatctttgccg
aaccatgcccggaattgcgtcaagatggggcttgacatgtgccggtccattaagaagctg
cgtgatgccaccggagtggacatcaatatgagagttggagtccattcgggaaatgtcctg
tgtggggtgataggtcttcaaaagtggcaatatgatgtctggtctgatgatgtgacatta
gccaatcacatggaggcaggaggcgtgccagggagagttcacatcacagaagctaccttg
tcacacctgggtggaatgtacaccgtggaggaagtttgctgtgtgcgagacacttacttg
agggagaaccgcatcaagactttcttagttgttgatcccaaagctgaagaagaaagttct
catgaccttctctcacctgcaccgggtgagagcctcacgatgagggcctctgtccggatg
actcgctacctggaatcatggggagctgccaaaccttttgccaacttcaaacctctggat
aatctcccagcagaggcaacaggatttgttcggaataaccattcggatatctctttggga
tctttgacaatggaacggtgccgtgcccccaggagccctgatgaagacttggaaggtgtg
gacgagaagttcttccaactgattgaacagctgaattcccagaagcaatggaagaaatct
gaagacttcaactgcatcacattgtacttcaagcaggaatctctggagaaggagtaccgg
ctttcaccattaccatcttttaattactatacggcctgcagcttcctggtcttcgtttcc
aactttctcatccagatccttgtcgtttataaaacagaagcactggggatctcctatgga
atttctttcttcttgtttctcctcctccttctcacctgcttttctggtcacctggcgaaa
tgtttcctgaaaggtcccaagatcttctattgggttccatccatcttggccaatgtttgc
actcaaccatggctacgtgtctccttgggcatcatcactattcttgtggttctcacaatg
tcagtgttgaacttgttctttatgccagaaacctcatgctttgtgaagcttgaaaattct
accttatcaagcatgaatactgtacaggaattctctcggtttaactccctcttcagtgtg
ccgtattatatctactgctgtgtcctgggattcctctcgtgctccctcttcctccacatg
aacttcgagctcaagttgaccatgctgatactgtgtcttgtcgtctacaatgtgctcttc
cttcacacccattcctggctctctgactgctatgtctctcagctgtaccataaccaaact
gcactcagacctggggtgctgaaggagcccaaggtgatgggagcattctcattcttcatt
ttcttcttcaccctcttgggtctggctagacagaatgagtattactgccgcttagatttt
ctctggaagaagaagttcaagaaagaacgtgaagagattgaaaccatggagaacctcaac
cgggtcctgttggaaaacgttctcccagctgatgtagcccagcagttcattcgccagaac
cggcgcaatacggatctctatcaccaatcttatgattgtgtctgtgttctcttcgcttcg
atcccggacttcaaagaattttattctgaatccaacgtcaaccatgagggacttgaatgc
ctccgactgctcaacgagatcattgctgactttgatgagctgcttctgaaaccgaaattc
agtggggttgagaagatcaaaaccattggaagcacttacatggcagctactggcttaaac
gtggcagctggccaggatagccaacaggtgatgtcttcatttaggatgactctactcatc
ctgaatctttcaacgggaatgagatttcatgctctgtttccacattag

DBGET integrated database retrieval system