KEGG   Thamnophis sirtalis: 106549712Help
Entry
106549712         CDS       T06107                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00564  Glycerophospholipid metabolism
tsr00565  Ether lipid metabolism
tsr00590  Arachidonic acid metabolism
tsr00591  Linoleic acid metabolism
tsr00592  alpha-Linolenic acid metabolism
tsr01100  Metabolic pathways
tsr04010  MAPK signaling pathway
tsr04217  Necroptosis
tsr04270  Vascular smooth muscle contraction
tsr04370  VEGF signaling pathway
tsr04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106549712 (PLA2G4A)
   00565 Ether lipid metabolism
    106549712 (PLA2G4A)
   00590 Arachidonic acid metabolism
    106549712 (PLA2G4A)
   00591 Linoleic acid metabolism
    106549712 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    106549712 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106549712 (PLA2G4A)
   04370 VEGF signaling pathway
    106549712 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    106549712 (PLA2G4A)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    106549712 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    106549712 (PLA2G4A)
Enzymes [BR:tsr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     106549712 (PLA2G4A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 106549712
NCBI-ProteinID: XP_013922893
Position
Unknown
AA seq 740 aa AA seqDB search
MSSIDPYQQIMVEHQYSHKFTVTVKQAKNVTKGAFGDMLDTPDPYVEIFIPTAPDSRKRT
NYINNNVNPEWNETFEIILDPNQENILEITLMDANYVMDETIGTATFPISSLKIGEKKQV
PFIINKVTEVTLEVSLEVCSSSTDLRFSMALCDEEKDFRQQRKTRAMHHLNKLLGADLTS
IRDVPVIAILGSGGGFRATVGFSGVIKALYESGILDCATYIAGLSGSTWYMSTLYSHPDF
PVKGPKEINVELRNSISHTPLKLLTPQKVKRYIEALWKKKRSGQPVTFTDIFGMLIGETL
IQNRMDNTLSHMKEKINKAQSALPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFM
SPNLFGSKFFMGTVVKKYKENPLHFLMGIWGSAFAILFNRVLGVSNNQNKGPTMEEELEN
IRMRQIVSNDSDSDDESQGPKGSENPHAEKSHEESWVQRMFMALVGDSTLFNTREGRAGK
VHNFMLGLNLNTCYPFSPFVGVTTQESVEDDEMDTAVTDPNEFDRILEPLDVKSKKIHVV
DSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKEILLAEKWAKMNNLPFPKID
PNVFDREGLKECYVFKPKNPASEIDCPTIIHFVLANISFRNYKAPGVPRETQEEKDFADF
DIFDDPDSPFSTFNFQYSHEAFNRLHDLMEFNTLNNLHVIKDVITDSIEYRRQNPSRCSV
SLSNVEARRYFNKAKSNNHT
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtatagatccgtatcagcagattatggtggaacatcagtattcgcacaaattt
actgtgacagttaagcaggcgaaaaatgtcaccaaaggggcttttggagatatgttagac
actcctgacccctatgtggagatctttattcccacggcaccagacagcaggaagagaaca
aactatatcaacaacaatgtgaaccctgagtggaatgaaactttcgagataattttggac
cccaaccaggaaaatattctggagattactcttatggatgcaaattatgtgatggatgag
actattggtacagcaactttccccatttcatctttgaaaattggggagaagaaacaagtt
ccattcatcattaataaagttacagaagtcacgttggaggtatctcttgaagtttgcagc
tcttcaacagatctccgtttcagcatggctctgtgtgatgaggagaaggacttccgacag
cagcggaaaactagagcaatgcatcatctgaacaagttattgggagctgatttgacctcc
attcgtgatgtgccagtaatagcaatcttgggatctggaggaggatttcgggcaactgtg
ggattttctggagtaataaaagcactgtatgaatctggaattttagactgtgcaacatat
attgctggattatctggatccacatggtatatgtcaaccctgtattctcatccagatttc
ccagtgaaaggcccaaaggagataaacgttgagttgaggaacagtattagtcacacccca
ctgaagctacttacaccacagaaagtgaagcgatacattgaagcactgtggaagaagaag
agatccggccagcccgtgacattcacggacatctttggaatgctgataggagaaacactg
attcaaaatagaatggataacactttatctcacatgaaggaaaaaatcaacaaagcgcag
tcggctttgccactttttacctgtcttcatgttaaacctgatgtgtcagaattgatgttt
gcagactgggtggagttcagtccctatgagattggaatggctaaatatgggaccttcatg
tctcccaatctgtttggcagcaagttttttatgggcacagtagtgaaaaaatacaaagag
aaccctctgcatttcttaatgggtatctggggaagtgcatttgctatactgttcaacaga
gtgcttggggtatctaacaatcaaaataaaggacccacaatggaagaagaactagaaaat
atcaggatgcgacagattgtaagcaatgattcagacagtgatgatgaatcacagggccca
aaaggctcggaaaacccccatgctgaaaaatctcacgaggaaagctgggttcagaggatg
tttatggcactggtaggcgacagcacccttttcaacacccgggagggccgggctggcaaa
gttcacaatttcatgttgggcttgaatctcaatacttgctatccgttttcccctttcgtc
ggggtcaccactcaggaatcagtggaggacgatgaaatggatactgcggtaacagatccc
aatgaatttgacaggatattggaacctctggatgtaaagagtaaaaaaattcatgttgtg
gacagtggacttacttttaatttgccatatccgcttatcttaagaccacagcgaggagtg
gatcttattatctcgtttgatttttcggctcgccccagtgattctagccctccttttaag
gaaattttacttgctgaaaaatgggccaaaatgaacaaccttcctttcccgaaaatagac
ccaaatgtgtttgatcgtgaagggttaaaagagtgctacgtcttcaaacccaaaaatcct
gcatccgaaatagattgtcccacgattattcattttgttttggccaatatcagcttcaga
aattacaaagcaccaggtgttccaagggaaactcaagaagagaaagattttgctgacttt
gatatttttgatgatcctgactcaccattctccaccttcaatttccagtattcccatgag
gctttcaacaggttgcacgatctgatggagttcaatacccttaacaacttacatgtaatc
aaagatgtgataacagacagtattgagtatagaaggcagaacccatcacgctgttctgtg
tccctcagcaatgttgaagcaaggagatacttcaacaaagcgaaaagcaataaccataca
taa

DBGET integrated database retrieval system