KEGG   Thamnophis sirtalis: 106550138
Entry
106550138         CDS       T06107                                 

Gene name
TM7SF2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00100  Steroid biosynthesis
tsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    106550138 (TM7SF2)
Enzymes [BR:tsr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     106550138 (TM7SF2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 106550138
NCBI-ProteinID: XP_013923428
UniProt: A0A6I9YGL0
Position
Unknown
AA seq 391 aa
VAFLMVLLPSTVFYLLLVCRTEQASVLNPPWPLPSLRSLWSPQDFALVLAWLAFQALLYQ
LPLGKITEGSLLRDKSRLKYRINGLYAVLVTAVMLGAGLARGLRLSYIYDHILQLAFAAT
VLAFVLSALLYFKALLAPEAALAPGGNSGNLIYDFFMGHELNPRFGLFDLKVFFELRPGL
LGWVSVLGMEGRRIYGRGWLENKGIQDMGKILRLEAVLTTMDIIHDGFGFMLAYGDLAWV
PFLYSLQACFLVTHPQKLSLPLAGGIVLLNGLGYSIFRGANSQKNTFRXXXXXXXXXGLR
TIPTATGRRLLVSGWWGFVRHPNYLGDLIMAFAWSLPCGFTHILPYFYIIYFTLLLAHRD
ARDDHQCLRKYGLAWHEYCRRVPYRIVPYLY
NT seq 1178 nt   +upstreamnt  +downstreamnt
gggtggccttcctgatggttctgttgcccagcaccgtcttctacctactgctggtctgca
ggacagagcaggccagcgtgctgaaccccccctggccgctgccctccctccgctccctct
ggagcccccaagactttgctctggtcctggcctggcttgcattccaagccctgctctatc
agctgcccctggggaagatcacggaaggaagccttcttcgggacaagagccggctgaaat
atcgcattaatggtctctatgctgtgttggtcacagcggtgatgctgggtgctgggctgg
ccagggggctgcgcctgagttacatctacgaccacatcctgcagctggccttcgcggcga
cggtcttggctttcgtcctcagcgcccttctctatttcaaggctctgctggccccagagg
cagctctggctcccggcgggaactcaggaaacctcatttatgacttcttcatgggccacg
agttgaatccacgctttgggctcttcgatctcaaagtcttctttgagttgcgcccaggtc
tccttggctgggtaagcgtccttgggatggaggggaggaggatatatggccgaggttggc
ttgagaataaaggaattcaagacatggggaagattttacgattggaggccgttctcacca
caatggatatcatccatgatggcttcggtttcatgctggcttacggggacctggcttggg
tgcccttcctgtacagcctccaggcgtgcttccttgtgacccacccccagaagctcagcc
tgcctctggcggggggcatcgtcctgctaaacggcctggggtattctatattccgtggtg
ctaattcccagaaaaacaccttccgannnnnnnnnnnnnnnnnnnnnnnnncagggctcc
ggacaatccctacggcaaccggtcggcggctcctggtctctggctggtggggttttgtgc
ggcaccccaactatttaggagacctgatcatggcttttgcatggtccttgccctgcggct
tcactcacatcttgccttatttttatatcatctatttcaccttgctgctggctcatcggg
atgcccgggacgaccaccagtgcctgaggaagtacgggctggcgtggcacgaatattgcc
gccgggtcccttaccggattgtcccatatctctactga

DBGET integrated database retrieval system