KEGG   Thamnophis sirtalis: 106550977
Entry
106550977         CDS       T06107                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00230  Purine metabolism
tsr00240  Pyrimidine metabolism
tsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106550977 (DCK)
   00240 Pyrimidine metabolism
    106550977 (DCK)
Enzymes [BR:tsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     106550977 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin AAA_33 MMR_HSR1
Other DBs
NCBI-GeneID: 106550977
NCBI-ProteinID: XP_013924442
UniProt: A0A6I9YJM0
Position
Unknown
AA seq 254 aa
MATPPKRSRSGVKKIAIEGNIAAGKSTFVNILKKAREEWEIVPEPVEKWCNVQDCRDDCE
ELTASQKSGGNLLQMMYEKPERWSFTFQAYACLSRIRAQLKSLEGKLKEPENAVVFFERS
VYSDRYIFASNLYESDCMNETEWTIYQDWHSWMNQQYGSSLELDGIIYLRATPEKCLDRI
YIRGRDEEQGIPMEYLEKLHYKHESWLQHRTLRTEFEYLQKVPVLTLDVNEDFKGNRDKH
ENMIEKVQEFLSTL
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcaactccacccaagcggagccgcagcggcgtgaagaagatcgccatcgagggcaat
atagccgcaggtaaatctacctttgtgaatattctcaaaaaagcccgagaggaatgggaa
attgttccagagccagtggaaaaatggtgcaatgttcaagactgccgcgatgactgtgag
gagctgacagcctcacaaaagagcggtggaaaccttcttcaaatgatgtatgagaagccg
gagagatggtcctttacttttcaagcctacgcctgtctaagcagaatcagggctcaactc
aaatcccttgaagggaaactaaaagaacctgagaacgctgtggttttctttgaacgatcc
gtttatagtgacagatacatctttgcatccaatttatatgaatctgattgcatgaatgaa
acagagtggactatttatcaagattggcacagttggatgaatcagcagtatggatcgagc
cttgaactggatggcattatttatctccgagctactcctgaaaaatgcttggataggatt
tacatccgtggaagggatgaagagcaaggcattcccatggaatatctggagaaactccat
tacaaacacgaaagctggctccagcatcggacattacgaacagagtttgaatacttgcaa
aaagtacccgttttaaccctcgatgtaaatgaagatttcaaaggcaacagagacaaacat
gaaaatatgattgagaaggtccaagaatttttaagtacattatag

DBGET integrated database retrieval system