KEGG   Thamnophis sirtalis: 106551273Help
Entry
106551273         CDS       T06107                                 

Gene name
HTR4
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04020  Calcium signaling pathway
tsr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    106551273 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106551273 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:tsr04030]
    106551273 (HTR4)
G protein-coupled receptors [BR:tsr04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    106551273 (HTR4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 106551273
NCBI-ProteinID: XP_013924810
Position
Unknown
AA seq 360 aa AA seqDB search
MLELITSKIHSTEGFGVAEKITLLTFISAVILMAILGNLLVMVAVCRDRQLRRIKTNYFI
VSLAFADLLVSVLVMPFGAIELVQDNWIYGRMFCLVRTSLDVLLTTASILHLCCISLDRY
YAICCQPLVYRNKMTPLRIALLLSGCWVIPMFISFLPIMQGWNSIGIMDLVEKRQFNNES
NSTYCIFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYITAKEHAHQIRILQRAGAPTDGR
SQHPDQHSTHRMKTETKAAKTLCIIMGCFCLCWAPFFITNIIDPFIHYAVPDQIWTAFLW
LGYINSGLNPFLYAFLNKSFRRAFLIILCCGDERYRRPSILEQTVPCSTTTINGSTHVLR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaactaataacttctaagatacactcaactgaaggatttggcgtggcagagaag
attacactgctcacttttatttcagcagttattcttatggctatcctggggaatctattg
gtgatggttgctgtatgcagggacaggcaactgaggagaatcaagaccaattatttcata
gtctctctcgcctttgctgacttgctagtatctgttttggtgatgccatttggtgcaatt
gaactggttcaagataactggatttatggaaggatgttctgtttggttcgcacttctctt
gatgtccttctcactactgcatcaattcttcatctgtgctgtatctcattagacaggtac
tatgccatctgctgccagccattggtttacaggaataagatgactccactacgcattgcc
ctattgctgagtggctgctgggtaatcccaatgtttatttcttttcttcctataatgcaa
ggctggaatagcattggcatcatggacttggtggagaaaaggcagttcaacaatgaatcc
aactcaacttactgcatattcatggtgaacaaaccgtatgccatcacctgttcagtcgta
gcattctacattccatttctactaatggttctagcctattaccgaatatacattacagca
aaggagcatgctcaccagatacgaatcttacagcgcgcaggagcaccaactgatgggcga
tcccaacacccagatcagcatagcacacaccgtatgaagactgagactaaagctgcaaag
accctctgtatcatcatggggtgtttttgcttgtgctgggcacctttctttattacaaac
attatagaccctttcatacattatgcagttcctgatcagatatggaccgctttcttgtgg
ctgggatacatcaattcaggactgaatcccttcctttatgcattcttgaacaagtctttc
agacgtgccttcctcatcatcttgtgttgtggtgatgaacgatatcgaagaccttccatc
ttggaacaaacggtaccttgttctaccactactatcaatgggtcaactcatgtactgagg
tga

DBGET integrated database retrieval system