KEGG   Thamnophis sirtalis: 106551298Help
Entry
106551298         CDS       T06107                                 

Definition
(RefSeq) dedicator of cytokinesis protein 6-like
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
tsr  Thamnophis sirtalis
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tsr04131]
    106551298
Membrane trafficking [BR:tsr04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    106551298
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOCK_N Fer4_19
Motif
Other DBs
NCBI-GeneID: 106551298
NCBI-ProteinID: XP_013924853
Position
Unknown
AA seq 190 aa AA seqDB search
MQRLIQNNNIMFYELSKSPSLTIGSMIYVTLASQEEAIERCSIPDIPKEHFGQRILVKCL
SLKFEIEVEPIFGSLALYDVKEKKKISENFYFDLNSEHMKSLLRSHSTHPAISTLARSAV
FSLTHPSPEIFLVIKVRCLLSFFNSHICSHSNKCWREKMTIYTLILHECKIGSMFMHLLY
FGVSETNGSQ
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaggctaatacagaataacaacataatgttttatgagctttcaaagtctccatct
ctcacaattggttcaatgatatatgttactttggcttcccaggaagaggccatagaacgg
tgcagcatcccagatattccaaaggagcacttcgggcagaggatcttagtcaaatgcttg
tctctgaagtttgaaatagaagttgagcccatctttggatcactggcactttacgatgtg
aaagaaaagaaaaagatctctgaaaatttttattttgatctcaattcggaacatatgaaa
tcccttctccgatctcacagcactcatcctgccatctccacactagctcgctcagctgtg
ttctctcttacacatccttctccagaaatattcctggtgatcaaggtgagatgtttgttg
tcgttttttaatagtcacatttgcagccattccaacaaatgctggagagaaaagatgact
atatatacccttattttacatgaatgcaaaataggatcaatgttcatgcatctgttgtat
tttggagtctctgaaactaatggatctcaataa

DBGET integrated database retrieval system