KEGG   Thamnophis sirtalis: 106551759Help
Entry
106551759         CDS       T06107                                 

Gene name
EIF3A
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit A
  KO
K03254  translation initiation factor 3 subunit A
Organism
tsr  Thamnophis sirtalis
Pathway
tsr03013  RNA transport
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    106551759 (EIF3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:tsr03012]
    106551759 (EIF3A)
Translation factors [BR:tsr03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    106551759 (EIF3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCI
Motif
Other DBs
NCBI-GeneID: 106551759
NCBI-ProteinID: XP_013925383
Position
Unknown
AA seq 831 aa AA seqDB search
MPVYFQRPENALKRANEFLEVGKKQPALDVLYDVMKSKKHRTWQKIHEPIMLKYLELCVD
LRKSHLAKEGLYQYKNICQQVNIKSLEDVVRAYLKLAEEKTEAAKEESQQMVLDIEDLDN
IQTPESVLLSAVSGEDTQDRTDRLLLTPWVKFLWESYRQCLDLLRNNSRVERLYHDIAQQ
AFKFCLQYTRKAEFRKLCDNLRMHLGQIQRHHNQSTAINLNNPESQSMHLETRLVQLDSA
ISMELWQEAFKAVEDIHGLFSLSKKPPKPQLMANYYHKVSTVFWKSGNALFHASTLHRLY
HLSREMRKNLTQEEMQRMSTRVLLATLSIPITPEQTDIARLLDMDGIIVEKQRRLATLLG
LQSPPNRISLINDMVRFNVVQHVVPEVKELYNWLEVDFHPLKLCGRVCKVLNWVRDQSEK
EPELQLYIPHLQNNTILRLLQQVAQIYQSIEFSRLTTLVPFVDAFQLERAIVDAARHCDL
QVRIDHTTRTLSFGSDLNYCTREDAPLGPQLQSMPSEQIRNQLTAMSSALAKALEFIKPP
HLLLEKEEQHQLAVTAYLKNSKKEHQRILARRQTIEERKERLESLNIQREKEELEQREAE
LQKVRKAEEERLRQEAKEREKERILQEHEQIKKKTVRERLEQIKKTELGAKAFKDIDIED
LEELDPDFIMAKQVEQLEKEKKELQERLKNQEKKIDHFERAKRLEEIPLIKTAYEEQRVR
DMDLWEQQEEERITTMQQEREKALEHKNRMSRMIEDSDFFITRLKTARKSVYEEKLKQFE
ERLAEERGSRLEARKRERKEERRITYYREKEEEEQRLEEEKMLKDVCHGSY
NT seq 2496 nt NT seq  +upstreamnt  +downstreamnt
atgccggtctacttccagcggcccgagaacgccctgaagcgggcgaacgaatttcttgag
gttgggaagaaacagcctgctcttgatgttctgtatgatgttatgaaaagtaaaaaacat
cgaacatggcaaaagatccacgaaccaattatgctaaaatacttagaattgtgtgtggac
ctccggaagagccacctggcaaaggaaggattatatcaatacaagaatatatgccagcag
gtgaatattaagtccttggaggatgtagtacgagcttatttaaaactagcagaagaaaaa
actgaagctgctaaagaagaatctcaacagatggtcctagacatagaagatcttgataat
atccagactccagaaagtgttctcttaagtgctgtaagtggggaagatacccaagatcga
actgatcggttacttttgactccgtgggttaagtttctgtgggaatcatacaggcagtgt
ttggatcttctcagaaacaattccagagtggagagactctatcatgatattgcccaacaa
gctttcaagttttgtttgcaatatactcgtaaggctgaatttcgtaaactctgtgacaac
ttaagaatgcatttgggtcaaattcagcgtcatcacaatcaaagtacagcaatcaacctc
aataatccagaaagtcaatcaatgcatttggaaactaggcttgtacaattggacagtgct
atcagcatggagttgtggcaggaagcttttaaagctgtggaagatatacatgggctattt
tccttatccaaaaagccaccaaagccccagctgatggcaaattattaccacaaagtttct
actgtattttggaaatcaggaaatgctctttttcatgcatctacacttcaccgtctttat
catctttcaagagaaatgcgaaaaaatctcacacaagaggagatgcagaggatgtcaaca
agagtgcttttggctactctctcaattccaataactcctgaacaaactgacattgctcgg
cttttggacatggatggcataattgttgaaaagcaacgccgattggcaacattgttagga
cttcagtctccacctaatcgaatttctcttattaatgatatggtgagatttaatgtagtt
cagcatgttgtcccagaggtaaaagagctttataactggcttgaggtagattttcatcca
ctaaagttatgtggccgcgtatgcaaggttttaaactgggtaagagatcaatctgagaaa
gagccagaattgcaattatatattcctcatctgcaaaacaacaccatccttagattactt
cagcaggtggctcaaatttatcaaagcattgaattttctcgcttaactactttggttcct
ttcgtggatgctttccaactagagcgcgccattgttgatgcagccagacactgtgattta
caagttcgcattgatcataccacccgaacattaagttttgggtccgatttaaactattgc
acccgagaagatgctcctcttggacctcagctgcagagcatgccttctgagcagattagg
aaccagctgacggccatgtcatctgcacttgcaaaggctctagaatttattaagccacct
catctattgctagaaaaggaagaacaacatcaactggcagttacagcttacttaaaaaat
tcaaagaaagaacatcagcgtatccttgcccgcaggcaaactattgaagaaagaaaggaa
cgtcttgagagtttgaacattcagcgtgaaaaagaagagctggagcagcgtgaagctgaa
ctccaaaaagtgcgtaaagctgaagaagagagactgcgccaggaggcaaaagagcgtgaa
aaagagcgtattctgcaggaacatgagcaaattaaaaagaaaactgttcgtgaacgtttg
gagcagattaagaagacagagctgggagcgaaggccttcaaagatattgatattgaggat
cttgaagaattggatccagacttcattatggcaaaacaggttgaacagcttgaaaaagaa
aagaaggaattgcaagagcgactgaagaatcaggagaaaaagattgaccattttgaaaga
gcaaaacgtttagaagaaattccactgattaagactgcctatgaagaacaaagagtcaga
gatatggatctttgggaacagcaagaagaagaaaggatcaccaccatgcaacaggaacgt
gaaaaggctcttgagcataagaatagaatgtcacggatgatagaagacagtgattttttt
ataactaggctcaagactgcaaggaaatcagtttatgaggaaaaacttaaacaatttgaa
gaaaggttagcggaggaaagaggtagtcgtttagaggcacgtaagagagagcgcaaagaa
gaaagacgcatcacttactatcgtgagaaagaggaggaagaacaaaggttggaagaggag
aagatgcttaaagatgtgtgtcatggcagctactag

DBGET integrated database retrieval system