KEGG   Thamnophis sirtalis: 106552725Help
Entry
106552725         CDS       T06107                                 

Gene name
GRIA1
Definition
(RefSeq) glutamate receptor 1 isoform X1
  KO
K05197  glutamate receptor 1
Organism
tsr  Thamnophis sirtalis
Pathway
tsr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106552725 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tsr04040]
    106552725 (GRIA1)
Ion channels [BR:tsr04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   106552725 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6 DUF659 DUF2061
Motif
Other DBs
NCBI-GeneID: 106552725
NCBI-ProteinID: XP_013926544
Position
Unknown
AA seq 902 aa AA seqDB search
MQHIFAFFCTSFLGAALGVNFPSNIQIGGLFPTQQSQEHAAFMFALSQFTEPPKLAPQID
IVNISDSFEMTYTFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFVTPSFPVDTSNQ
FVIQLRPELQDALISVIEYYKCQKFMYIYDADRGLSVLQKVLDTAAEKNWQVTAVNVMTT
TEEDYKSLFQNLEKKKERVVVVDCESERLNAILGKIIKLEKNGIGYHYILATLGFMDIDL
VKFKESGANVTGFQLVNYTDTIPAMIMQQWKNNDAREQPRVDWKRPKYTSALTYDGVRVM
AEAFQSLRKQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGTVQFNEKGH
RTNYTLHVIEMKHDGIRKIGYWNEDEKFVPTITDQPANETTTLQNRTYIVTTILESPYVM
QKKSSEPLEGNLRYEGYCVELAAEIAKHVGYNYSLQIVADGKYGARDSESKMWNGMVGEL
VYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWM
CIVFAYIGVSVVLFLVSRFSPYEWHNEEVEEGRDHPANDQTNEFGIFNSLWFSLGAFMQQ
GCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAY
GTLDGGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVPTTEEGMKRVRRSKGKYAYLLEST
MNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRNPVNLAVLKLNEQGLLDKLKNKWW
YDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKG
FCLIPQQSINEAIRTSTLPRASAAGTSSGENGRVVSHDFPQTMQEIPCMGHNSGMALGAT
GL
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccagtttcctaggggcagcgttgggggtcaat
ttccccagcaacatccagatcgggggattatttcctactcaacaatcccaggaacatgca
gcctttatgtttgcattatctcagttcacagagccccccaagctggctccacagattgat
attgtgaatattagtgacagttttgaaatgacctacaccttctgttcccagttctctaag
ggggtctatgctatctttggcttctatgagaggaggactgtcaacatgctcacgtccttc
tgtggggcactacatgtctgctttgtaacacccagcttccctgttgacacatccaatcaa
tttgttattcagctgcgccctgaacttcaggatgccctcatcagtgtcattgaatattac
aagtgccagaagtttatgtacatttatgatgctgaccggggtttgtcagtgctgcaaaag
gtgttggatacagctgcagagaaaaactggcaggtaacagcagtcaacgttatgacaaca
acagaagaggactataagtcactcttccaaaatttggagaagaagaaagaacgggtcgtg
gttgttgactgtgaatcagaacgactaaatgctatcttaggcaagataatcaagcttgaa
aaaaatgggataggataccactatattcttgcaactttgggatttatggatattgacctg
gtgaaattcaaagaaagtggagcaaatgtgactggattccaactggtgaattacacagac
accatcccagctatgatcatgcaacagtggaaaaacaatgatgcaagggaacaacctcgg
gtggactggaagaggccaaagtacacatctgctcttacgtatgatggggttcgggtaatg
gcagaagcctttcagagtctcagaaaacaacggatcgatatttcccgtcgtgggaatgct
ggggattgtctggcaaatccagctgttccttggggacaagggattgacatccagagagct
ctacaacaggtgcgctttgaaggactcacaggaactgtccagtttaacgagaaaggacat
cgaactaattacacccttcatgttattgaaatgaaacatgatgggatcagaaagattgga
tattggaacgaagatgaaaaatttgttccaaccatcacagatcagccagcaaatgaaaca
acaactctgcagaacaggacctatattgtcacaactattcttgaatctccatatgtgatg
caaaagaagagcagcgagccattagaaggaaatctgagatatgagggatattgtgtagaa
ttagctgctgaaattgcaaaacacgttggctacaactacagcttgcagattgttgctgat
ggaaaatacggtgctcgagattctgaaagtaaaatgtggaatggcatggttggagagcta
gtctatggaagagctgatgtggctgttgcaccattaactataactctagtgcgagaagaa
gttatagacttttccaaaccttttatgagcctgggcatatctatcatgattaaaaagcct
caaaaatccaaacccggggtattttccttcctggatcctttagcttatgagatctggatg
tgcatagtttttgcctacattggtgtcagtgttgtcctctttctggttagccgcttcagc
ccttatgaatggcacaatgaggaggttgaggaaggccgtgaccacccagctaatgaccag
accaatgaatttggaatatttaatagcctgtggttctccttgggagcttttatgcaacaa
ggatgtgatatatctccaagatccctgtctggacgcatagttggtggagtttggtggttt
tttactttgatcatcatttcatcttatacagccaatttagctgcatttttaacagtagag
aggatggtgtctcccatagagagcgcagaagacttggccaagcaaacagagattgcttat
gggactttggatggtggttctactaaagaattctttcggagatctaaaatagcggttttt
gagaagatgtggacgtacatgaagtcagctgagccctctgttttcgtgccgacaacagaa
gaggggatgaagcgtgtgaggagatccaaagggaagtatgcctacctgctagagtccacc
atgaatgagtacattgaacagcgaaaaccatgtgacaccatgaaggtgggaggtaacttg
gattccaaaggctatggcattgcaacgccaaaaggttcaccgctgagaaacccagtaaac
ctggcagtgttaaaactgaacgagcaggggcttttggacaaattgaaaaacaaatggtgg
tacgacaagggcgagtgcggcagcgggggaggtgactccaaggacaaaacaagcgctctg
agtctcagcaacgtggccggggttttctacatcctcatcggtggtcttggactagccatg
ctggttgccttaatcgagttttgttacaagtccagaagtgaatcaaaacggatgaagggt
ttttgtttgatcccacagcaatcaatcaatgaagccatacggacatcaaccctccccaga
gcatctgcagcaggaaccagcagtggagaaaatggacgggtggtgagccacgattttccc
caaaccatgcaggagattccatgcatgggtcacaactctgggatggccctgggagcaacg
ggattataa

DBGET integrated database retrieval system