KEGG   Thamnophis sirtalis: 106552746Help
Entry
106552746         CDS       T06107                                 

Gene name
MARS
Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tsr  Thamnophis sirtalis
Pathway
tsr00450  Selenocompound metabolism
tsr00970  Aminoacyl-tRNA biosynthesis
tsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    106552746 (MARS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106552746 (MARS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tsr01007]
    106552746 (MARS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tsr03016]
    106552746 (MARS)
Enzymes [BR:tsr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     106552746 (MARS)
Amino acid related enzymes [BR:tsr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   106552746 (MARS)
Transfer RNA biogenesis [BR:tsr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    106552746 (MARS)
 Prokaryotic type
   Other AARSs
    106552746 (MARS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 GST_C_3 GST_C_2 GST_C GST_C_6
Motif
Other DBs
NCBI-GeneID: 106552746
NCBI-ProteinID: XP_013926569
Position
Unknown
AA seq 844 aa AA seqDB search
MKAHSPSTNVISQYFFRLSGKEISSFSNEQSDFANQFFEWDITELQPALSAALYLHVVQE
KKGEDVLGIIRKPLDYLDQILTKKGTSYLTGDVESAADIVLWGSLFPLLRDDSFLPNELK
ALRSWFQNMNLKEYCRKAVESVWTPKGLLELKAYLQKHPTPSLSFEKSATNEAKEEESAQ
QHLSDVEIEAIAQIWTRGPASLPSPWKPQHPILPVEGMKNVLITSALPYVNNVPHLGNII
GCVLSADTFARYCRLRNWNTLYICGTDEYGTATETKAMEEGLTPQQICDKYYSIHAQIYQ
WFNISFDYFGRTTTAHQTTIAQTIFQQLLERNYLLRETVDQLKCEKCARFLADRFVEGIC
PFCNYEEARGDQCDKCGKLINATELKKPVCKICQGTPVVKSSQHLFLDLPKLEESLEKWL
AVSQSSGDWTPNSRYIARSWIRDGLKPRCITRDLKWGTPVPLDGFREKVRNGTEGDIFSV
IECHTIIDIKYKGTPHQIQLYNFMAKDNVPFHSVVFPCTLLGTGDNYTLVNHLIATEYLN
YEDGKFSKSRGVGVFGDMAKDTGIPADIWRFYLLYLRPESQDSAFSWNDLMTKNNSELLN
TLGNFINRAGTFVCKFFGGCVPTMDLTQDDKRLLAHITLELRQYNQLLEKVKIRDALRSI
LNIARHGNQYLQVNEPWKCIKGSNADKKRASTVIGVAINIASLLSVVLQPYMPNVSATIQ
DQLCIASSFNVVTNDFVCTLPAGHQIGTVTPLFQKLEAEQIENLRKRFGGGQFEDFPLKP
KQKASANIQKTLGGKEHQEGERGNHVKNAKAQSARKEQVEVMVSDLVELQKQHHVVEGKG
KKKK
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcccactccccgtccacaaatgtaatttctcaatactttttccgcttatctgga
aaagaaataagcagttttagcaatgagcagagtgattttgccaatcagttttttgaatgg
gatataactgagctacagcctgctttgtctgcagccttgtatcttcatgtggtacaagaa
aagaaaggagaggatgttttgggcatcattcggaagccactggattaccttgaccagatt
cttaccaaaaagggtacctcttacctcactggggatgttgaatcagctgctgatattgtc
ttatggggatctctgtttcctttgttaagagatgattccttcttaccaaatgagctgaaa
gctctgaggagttggttccagaacatgaacctgaaggagtactgcagaaaggcagtggaa
tctgtatggacacccaagggattgctggaacttaaagcctatctacagaaacatcctact
cccagtttgtcttttgagaaatcagctaccaatgaagccaaggaagaggaatcggcccag
cagcatttgtctgatgtggagattgaagctattgctcaaatctggaccagaggacctgcc
agccttcctagcccctggaaaccacagcaccctatattgcctgtggaaggcatgaagaat
gtgctaatcacaagtgcgctgccatatgtaaacaatgtgcctcatcttggaaatatcatt
ggctgtgttctcagtgctgatacatttgccagatactgtcgtctacgcaactggaacacc
ctctatatatgtggtactgatgaatatggtactgccacagagacaaaggccatggaggaa
ggactgacaccacaacagatctgtgataaatactattctatccatgcacaaatctaccag
tggttcaacatctcttttgactactttggtcgcacaaccacagcccatcagaccacaata
gcacaaaccatcttccaacagttgctggagcgcaactatctcctgagagagacagtggac
cagttgaagtgtgagaaatgtgcaagattcctagcagaccgatttgtggaaggcatttgc
cctttctgcaactatgaagaagcccgtggagatcagtgcgacaaatgtggcaagctcata
aatgccactgaacttaagaaaccagtgtgcaaaatctgccaaggaacccctgtagtgaaa
tcttctcagcaccttttcctggatctacccaagttagaagagagtctggagaaatggttg
gctgtgtcccagtccagtggggattggacccccaactcaaggtacatcgcccgctcctgg
atccgggatggcctcaaaccacgttgcatcactcgtgacttgaagtggggcacaccagtt
ccacttgatggcttccgtgagaaggtgaggaatgggacagagggagacattttttctgtg
attgaatgtcacactattatagacataaaatataaaggcaccccccaccaaattcagctt
tataacttcatggccaaggataatgttcccttccacagtgttgtatttccttgcacattg
ctgggcactggtgataattatactctggtcaaccatctaattgcaacagaatatttgaac
tatgaggatggcaaattctccaaaagccgtggtgtgggagtttttggcgatatggccaag
gacaccggcattcctgcagacatctggcgcttttatctgctctacttgcggccagagagc
caagacagtgccttctcttggaatgatctcatgaccaaaaacaactcagagctgctgaac
acccttggcaattttatcaatagagcggggacttttgtgtgcaaattcttcgggggttgc
gtccctacaatggacttaacccaggatgataagcgcttgttggctcacatcactttggag
ctgcggcaatacaaccagttgttggagaaggtcaagattcgtgatgccttacgcagcatc
ttgaatattgctcgccatggcaaccagtaccttcaggtcaatgagccctggaaatgcatc
aaaggcagtaatgcagataaaaaacgggcaagcaccgtgataggggtggctataaacatt
gcaagcttgttatcagttgtgttgcaaccttacatgcccaatgtgagtgctacaatccag
gaccaactgtgcattgcatccagctttaatgttgtgaccaatgacttcgtctgcaccttg
ccggctggacatcaaattggcacagtgactcctttgttccaaaagttggaggctgaacaa
attgagaacttgaggaagcgtttcggtggaggacagtttgaagacttcccactgaagcca
aagcaaaaagcatctgcaaatatccagaaaactttgggagggaaggaacatcaggaagga
gaacggggtaaccatgtaaaaaacgcaaaggcccagagtgccagaaaagagcaagttgaa
gtcatggtctcagacctggtggaactacagaagcagcaccatgtggtagaaggaaaaggg
aaaaagaaaaagtga

DBGET integrated database retrieval system