KEGG   Thamnophis sirtalis: 106553473
Entry
106553473         CDS       T06107                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
tsr  Thamnophis sirtalis
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tsr01009]
    106553473 (AKAP5)
Protein phosphatases and associated proteins [BR:tsr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     106553473 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 106553473
NCBI-ProteinID: XP_013927453
Position
Unknown
AA seq 490 aa
MEAQNMEHSAKGIQMDTEQRLETSNTTDPIIAPDSPATKASIFCFKKRKKSCEKGEEKDE
NHESISLSLRPANQSSDMGHNEAEVSNPFWTSGGAWLAFKRLVTLRRRSKSSLKKQTQAC
SRVHLEVDRGDSGRKHASSSSKIPCLRLSRSKKRTSHSQIIEQPDGEKKGNDTASIVNNK
SNKEPEIVAMEVPLDAKQSPSRGLQEGESDSGAMTNTENAALSNRENTFPDPNCYADCGV
PSEIIHSETALVTEEEKQIFQLHHGTLYGNFEELENQKFSFNVEISPPIPQDLPESEQQL
IGREGTKETKSQPFGAGIDVVGKSEDAAAKEGHSIEVMLHCSPSAMEDEASDIPVHFDEE
EKSEGNQFTLPGAGIVIMITEAEDDQDEEEESAPPCEMFAFPQAIKQKGKKKSSKNKTPT
AGCNHTKEDQECSQVPSSFGTNSQEHWTSEQYEMLLIETAASLVKTAIQSSVEQLVNEMA
LEQNQQNSVL
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggaagcccaaaatatggaacattcagcaaaaggaattcagatggacactgagcaacga
ttggaaacttcaaatacaactgatccaattattgctcctgacagtccagccacaaaggct
tctatcttttgctttaagaaaaggaaaaagtcttgtgagaaaggagaggagaaggatgag
aaccatgaatccatttcacttagcttaaggcctgctaaccaatcttctgacatggggcac
aatgaagcagaggtttcgaatccattttggacttcaggaggggcctggctggctttcaaa
cgactagtaacattaaggagaagatccaaatcctctctgaagaagcaaacacaggcttgt
tctcgcgtacatctagaggtggacagaggagattctggcaggaagcatgccagttctagt
tctaagattccctgcctaagactctcccgaagcaaaaaaaggaccagccattctcaaata
atagaacagcctgatggcgagaaaaaaggaaatgatacagcaagcatcgtgaataacaaa
agtaacaaagagccagagattgtggctatggaagttccccttgatgcaaagcaatctccc
agcagaggacttcaggaaggagaaagtgacagtggagccatgacaaatacggaaaatgcg
gcactctccaatagagagaacacatttcctgatcccaattgttatgctgactgtggtgtt
ccatcagaaataatccattctgaaactgcccttgtaactgaagaagagaagcaaatattt
cagttgcatcatggaacgctctatggaaactttgaagagctggaaaatcagaagttcagt
tttaacgttgagatcagtcctcccattcctcaggacctgcctgaaagtgaacagcaactt
ataggaagagagggaaccaaagaaaccaagtcacagccatttggggcaggcattgatgtg
gtgggcaaaagcgaggatgcggctgctaaggaaggccattccattgaagtgatgttgcat
tgcagcccatctgcaatggaagacgaggcttcagacataccggttcattttgatgaggaa
gagaaaagtgaaggaaatcagtttacccttcctggggctggcattgtaatcatgatcact
gaggctgaagatgatcaggatgaggaagaagaatcggcccctccctgtgaaatgtttgca
tttccccaagccatcaagcaaaaagggaagaaaaaaagtagcaaaaacaaaactcccact
gcagggtgcaaccacacaaaggaagaccaagaatgctcccaggtcccatcttcctttggc
accaacagccaggaacactggacttcagagcaatatgaaatgctgttgattgaaacagct
gcctcgcttgtgaagacagccatccagtcatctgttgagcagcttgtcaatgaaatggcc
ttggagcaaaatcaacaaaacagtgttttatga

DBGET integrated database retrieval system