KEGG   Thamnophis sirtalis: 106553475Help
Entry
106553475         CDS       T06107                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock-related 70 kDa protein 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tsr  Thamnophis sirtalis
Pathway
tsr03040  Spliceosome
tsr04010  MAPK signaling pathway
tsr04141  Protein processing in endoplasmic reticulum
tsr04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tsr00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106553475 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106553475 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106553475 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106553475 (HSPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tsr01009]
    106553475 (HSPA2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tsr03041]
    106553475 (HSPA2)
   03009 Ribosome biogenesis [BR:tsr03009]
    106553475 (HSPA2)
   03110 Chaperones and folding catalysts [BR:tsr03110]
    106553475 (HSPA2)
   04131 Membrane trafficking [BR:tsr04131]
    106553475 (HSPA2)
   03051 Proteasome [BR:tsr03051]
    106553475 (HSPA2)
   03029 Mitochondrial biogenesis [BR:tsr03029]
    106553475 (HSPA2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tsr04147]
    106553475 (HSPA2)
Protein phosphatases and associated proteins [BR:tsr01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     106553475 (HSPA2)
Spliceosome [BR:tsr03041]
 Complex B
  Other components
   Prp19 complex
    106553475 (HSPA2)
 Complex C
   Prp19-CDC5 complex
    106553475 (HSPA2)
Ribosome biogenesis [BR:tsr03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    106553475 (HSPA2)
Chaperones and folding catalysts [BR:tsr03110]
 Heat shock proteins
  HSP70 / DNAK
   106553475 (HSPA2)
Membrane trafficking [BR:tsr04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    106553475 (HSPA2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    106553475 (HSPA2)
Proteasome [BR:tsr03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    106553475 (HSPA2)
Mitochondrial biogenesis [BR:tsr03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    106553475 (HSPA2)
Exosome [BR:tsr04147]
 Exosomal proteins
  Proteins found in most exosomes
   106553475 (HSPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Hydantoinase_A CRIC_ras_sig
Motif
Other DBs
NCBI-GeneID: 106553475
NCBI-ProteinID: XP_013927455
Position
Unknown
AA seq 635 aa AA seqDB search
MSAKAPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPNNTIFDAKRLIGRKFDDPTVQSDMKHWPFRVVSEGGKPKVQVEHKGESKSFFPEEI
SSMVLTKMKEIAEAYLGCKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGSRAGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHFVEEFKRKHKRDIAGNKRAVRRLRTACERAKRTLSSSTQASIEIDSLFDGIDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQINEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILMGDKSENVQDLLLLDVAPLSLGIETAGGVMTALIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAVDKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKAEDEANRERVV
SKNALESYAYNIKQTVEDDKLKGKISEQDKQRVLEKCQEVINWLDRNQMAEKEEFEHKQK
ELEKLCNPIIAKLYQGAGAAGAGAPGGGPTIEEVD
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccaaagcgcctgccataggcattgacttgggcaccacctactcctgcgtcgga
gttttccagcacgggaaagtggagattatcgccaacgaccaaggcaaccgcaccacaccg
agctatgttgcctttacggacacggaacgcctcatcggagatgcagccaagaatcaggtg
gctatgaatcccaacaacaccatttttgatgccaagcgtctcattggccgcaaatttgat
gacccaacggtgcagtcggatatgaagcactggcctttccgtgtggtgagtgaaggtggg
aagcccaaggtgcaagtcgagcacaagggtgagagtaagtccttctttcctgaagaaatt
tcctctatggtattgaccaaaatgaaggaaatagctgaggcttacctgggttgcaaagtc
cagagtgctgtgattactgtacctgcctacttcaatgactcccaacgccaagccactaaa
gatgcaggtaccattacaggtctcaacgtattgcgcatcattaatgagcccacggctgct
gccattgcctatggtttggataaaaaagggagcagagcaggtgagaagaatgttctgatc
tttgacttgggtggtggcacatttgatgtttccattttgaccatcgaagatggcatcttt
gaagtgaaatctactgctggagatacccacttgggtggggaggactttgacaatcgcatg
gtgagtcactttgtggaggaattcaagcgcaagcataagcgtgacattgctggcaacaag
cgagcagttcgacggctccgcacagcctgtgagagagccaagcgtaccctgagctcctcc
actcaggcttctattgagattgactcattatttgatggcattgatttctatacatccatt
acccgtgctcgctttgaggagctcaatgctgatctcttccgtggtactcttgaacctgtg
gagaaggctcttcgtgatgctaagctagacaaaggacaaattaatgaaattgttctggtt
ggtggctcaactcgtattcccaagatccaaaagttgctccaagacttctttaatggaaaa
gagctaaacaaaagcataaatcctgatgaagctgtggcatatggcgctgctgtgcaggct
gctattctgatgggtgacaaatcagaaaatgtacaagacctgctgctgcttgatgtagca
ccactttctctgggtattgagactgctggtggtgtgatgactgccttaatcaaacgcaac
acaactattcccaccaagcaaacccagaccttcaccacctattcagacaaccagagtagt
gtgctggtgcaagtatatgagggtgagagagccatgaccaaggacaacaatctgctgggc
aagtttgacctgacaggtattccacctgcacctcgtggtgtgccccagattgaggtgaca
tttgacatagatgcaaatggtatcctcaatgttactgcagtggacaagagcacaggaaaa
gagaacaagatcacaataactaatgacaaaggccgcctcagcaaagatgacattgaccgc
atggtgcaagaagcagagcgttacaaggcagaggatgaggctaaccgagaaagagttgtt
tccaaaaatgccctggaatcctatgcatacaacatcaagcagactgtggaggacgacaag
ctgaaaggcaagattagtgagcaagacaagcagagggtgcttgaaaagtgccaagaggtg
atcaactggctcgatcgaaaccagatggctgagaaggaagaatttgagcataagcagaag
gagctagagaagctttgtaaccccatcattgccaaattgtaccagggtgctggagctgca
ggtgctggtgctccaggtggtggtcccactattgaagaagtagattaa

DBGET integrated database retrieval system